BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0907.Seq (419 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_1002 + 10171942-10172859,10173369-10173452 27 4.6 02_05_0280 + 27435166-27435254,27436348-27436437,27436764-274368... 27 6.1 01_06_1128 - 34724469-34724699,34726103-34726213,34726301-347264... 27 8.1 >08_01_1002 + 10171942-10172859,10173369-10173452 Length = 333 Score = 27.5 bits (58), Expect = 4.6 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 163 RASRPKSLILMN--LDNFCRSHGQVPATHLSNVALSTFDGS 279 RA + SL L +DN CR G++P + +N+++ F G+ Sbjct: 242 RAPKLHSLTLWTPAVDNGCRVAGELPLLNAANISVDAFLGT 282 >02_05_0280 + 27435166-27435254,27436348-27436437,27436764-27436866, 27437318-27437377,27437745-27439148,27439227-27439328, 27439424-27439609,27439695-27439820,27439905-27440000, 27440509-27440574 Length = 773 Score = 27.1 bits (57), Expect = 6.1 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +1 Query: 94 NTCNQNSDQ*WDECFY*IKTNRRR 165 N+ N++SDQ +C+Y +KTNR++ Sbjct: 741 NSLNRSSDQ-ISKCYYSLKTNRKQ 763 >01_06_1128 - 34724469-34724699,34726103-34726213,34726301-34726409, 34726517-34726581,34726661-34726838,34726918-34726997, 34727838-34727961,34728064-34728172,34728299-34728461 Length = 389 Score = 26.6 bits (56), Expect = 8.1 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 44 FLRSYSVTWITVVILELIHAIRTLTSDGMSAF 139 F+R Y TW + +L+ + TLT S F Sbjct: 241 FIRCYDCTWTLIDEYDLVDPVHTLTPPEESGF 272 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,644,261 Number of Sequences: 37544 Number of extensions: 191947 Number of successful extensions: 422 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 766563072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -