BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0907.Seq (419 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical ... 28 3.1 Z66494-3|CAA91258.2| 520|Caenorhabditis elegans Hypothetical pr... 27 4.1 Z72507-8|CAA96632.1| 1101|Caenorhabditis elegans Hypothetical pr... 27 5.5 U42833-2|AAA83576.1| 1276|Caenorhabditis elegans Hypothetical pr... 26 9.5 >AF038611-7|AAB92040.1| 466|Caenorhabditis elegans Hypothetical protein E04A4.6 protein. Length = 466 Score = 27.9 bits (59), Expect = 3.1 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +2 Query: 11 DTANGSIYQFWFLRSYSVTWITVVILELIHAIRTL 115 D+ G++ WF +++SV WI +V+ I +T+ Sbjct: 224 DSLPGNVDNNWFEQTFSVYWIPLVVASEIETNQTV 258 >Z66494-3|CAA91258.2| 520|Caenorhabditis elegans Hypothetical protein C34C6.3 protein. Length = 520 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 53 SYSVTWITVVILELIHAIRTLTSDGMS 133 SY+V+WIT + IR + SDG++ Sbjct: 54 SYNVSWITPAASNSTYRIRLIDSDGLT 80 >Z72507-8|CAA96632.1| 1101|Caenorhabditis elegans Hypothetical protein F17C11.10 protein. Length = 1101 Score = 27.1 bits (57), Expect = 5.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 248 ERCVAGT*PCDLQKLSRFIKINDFG 174 ER V+ + P DL RF+K N FG Sbjct: 440 ERFVSNSSPMDLDATQRFLKYNRFG 464 >U42833-2|AAA83576.1| 1276|Caenorhabditis elegans Hypothetical protein ZK430.5 protein. Length = 1276 Score = 26.2 bits (55), Expect = 9.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +1 Query: 148 KTNRRRASRPKSLILMNLDNFCRSHG 225 K N +R +R + L++ + NFC+ HG Sbjct: 1229 KDNLKR-TRKRKLLVSTIPNFCKEHG 1253 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,735,817 Number of Sequences: 27780 Number of extensions: 154804 Number of successful extensions: 476 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 403 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 476 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 682028672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -