BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0903.Seq (499 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylch... 23 5.8 AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-b... 23 7.6 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 23 7.6 >AY705395-1|AAU12504.1| 569|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 2 protein. Length = 569 Score = 23.0 bits (47), Expect = 5.8 Identities = 8/34 (23%), Positives = 21/34 (61%) Frame = +1 Query: 103 RVIQVLLKHSPEDIINEITKELLDIIVQMGQSKY 204 R+ ++LL P D++ E+ ++ +++ +SK+ Sbjct: 360 RLPKLLLMRVPNDLLKELAANKINYGIKISKSKF 393 >AJ618920-1|CAF01999.1| 204|Anopheles gambiae putative odorant-binding protein OBPjj4 protein. Length = 204 Score = 22.6 bits (46), Expect = 7.6 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 403 NQKMQGEALRDAYKAVQK*NP 465 N+K+ G A R A + V K NP Sbjct: 95 NEKVDGPAFRKAIEPVVKANP 115 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 22.6 bits (46), Expect = 7.6 Identities = 7/21 (33%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = +3 Query: 255 HEVLKKFYGHIVSLST-HAIK 314 H+ +++FY H+++ T HA++ Sbjct: 272 HQEIEQFYAHMIATPTEHALR 292 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 494,659 Number of Sequences: 2352 Number of extensions: 9078 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -