BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0900.Seq (449 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-592|AAF45914.1| 402|Drosophila melanogaster CG15376-PA... 31 0.94 AY089381-1|AAL90119.1| 149|Drosophila melanogaster AT20622p pro... 28 5.0 AE013599-404|AAF59261.2| 149|Drosophila melanogaster CG11145-PA... 28 5.0 >AE014298-592|AAF45914.1| 402|Drosophila melanogaster CG15376-PA protein. Length = 402 Score = 30.7 bits (66), Expect = 0.94 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 108 VPAHGARPITKH*IITYINSERNPHLHGHQYKTTDTYL 221 VP H P T H ++Y + +PH H H ++ D+Y+ Sbjct: 323 VPPHH-HPYTVHHPVSYAHPHGHPHAHPHPHEHFDSYI 359 >AY089381-1|AAL90119.1| 149|Drosophila melanogaster AT20622p protein. Length = 149 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -2 Query: 319 QSSTIPILLSFVFSTVRVFGSNLPIRRDMLCVSKYVSVVLY*CPCRWGLRS 167 Q P LL F++S V +F +P+ +L + Y + Y +GL++ Sbjct: 41 QPLPFPTLLKFIYSWVLIFFIMIPMLYPLLVLLSYYGIFQYAAEEHFGLKT 91 >AE013599-404|AAF59261.2| 149|Drosophila melanogaster CG11145-PA protein. Length = 149 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -2 Query: 319 QSSTIPILLSFVFSTVRVFGSNLPIRRDMLCVSKYVSVVLY*CPCRWGLRS 167 Q P LL F++S V +F +P+ +L + Y + Y +GL++ Sbjct: 41 QPLPFPTLLKFIYSWVLIFFIMIPMLYPLLVLLSYYGIFQYAAEEHFGLKT 91 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,511,332 Number of Sequences: 53049 Number of extensions: 408533 Number of successful extensions: 1018 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1009 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1018 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1455824790 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -