BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0900.Seq (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 27 0.12 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 25 0.29 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 22 2.7 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 2.7 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 4.7 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 4.7 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 26.6 bits (56), Expect = 0.12 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 207 TDTYLLTHNMSLRIGKFEPNTRTVLKTNDNSIGIVE 314 TD+Y L ++ G+F NT V+ T SI + + Sbjct: 130 TDSYKLIGRIAAGEGRFNTNTEVVINTEVKSIPVTK 165 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 25.4 bits (53), Expect = 0.29 Identities = 13/54 (24%), Positives = 24/54 (44%), Gaps = 4/54 (7%) Frame = -1 Query: 152 NYLMFCYRSGTVCWDVNVKL----YCTITFDVVALMFCMIVSVTXQ*IVFLILS 3 +Y R+G CWD N +L + + + ++FC +S+ +LS Sbjct: 311 DYFTQINRNGIACWDTNTELNPNTFILVAENNTTMVFCNDLSIDRSTNTMYVLS 364 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 22.2 bits (45), Expect = 2.7 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = +3 Query: 357 RTLRPRGLNVWHSLIITSAYSSSCSHRRXVY 449 R +P + WH ++ + +SC R Y Sbjct: 76 RFRKPLPIEPWHGVLNATVLPNSCYQERYEY 106 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 22.2 bits (45), Expect = 2.7 Identities = 8/31 (25%), Positives = 14/31 (45%) Frame = +3 Query: 357 RTLRPRGLNVWHSLIITSAYSSSCSHRRXVY 449 R +P + WH ++ + +SC R Y Sbjct: 76 RFRKPLPIEPWHGVLNATVLPNSCYQERYEY 106 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 4.7 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = +1 Query: 163 ILSVIPIYTDISTKQRTHIYLHTTCPYESVNS 258 + + + + I + T++ L T CPY S S Sbjct: 611 MFNCVVVEETIPSLNSTNVTLSTKCPYPSYYS 642 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 4.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 298 LLSFVFSTVRVFGSNLPI 245 +L F+FS VFG+ L I Sbjct: 50 ILLFLFSVATVFGNTLVI 67 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,476 Number of Sequences: 438 Number of extensions: 2443 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -