BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0889.Seq (349 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 25 1.1 DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 23 3.2 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 24.6 bits (51), Expect = 1.1 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 117 IHSRNNCS*VVRSPSEALGQLLANPTP 37 + S ++C+ ++ P E LGQ +AN P Sbjct: 34 LQSVHDCTEYLQIPKERLGQYMANEFP 60 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 102 CFANESTTGSESRPAEKIRRETQRADAWVR 191 CF + + S+S +E + + +R+DA R Sbjct: 3 CFGSAGSKQSDSNSSEDTKSQKRRSDAITR 32 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 289,192 Number of Sequences: 2352 Number of extensions: 4544 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24935070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -