BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0881.Seq (329 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domai... 27 0.24 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 24 1.7 AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. 22 5.2 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 22 5.2 AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 21 9.1 >DQ370043-1|ABD18604.1| 161|Anopheles gambiae putative TIL domain polypeptide protein. Length = 161 Score = 26.6 bits (56), Expect = 0.24 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 159 YGDGKEYRICFRSKGIFFLDQACVKVCSRLNDTPGNTRRS 278 Y Y +C ++ + AC K C+ LND P R S Sbjct: 26 YAHPYPYDLCGPNEELLECGTACPKTCADLNDPPKCVRYS 65 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 159 YGDGKEYRICFRSKGIFFLDQACVKVCSRLNDTP 260 Y Y +C ++ AC K C+ LND P Sbjct: 26 YAHPYPYDLCGPNEEFQECGTACPKTCADLNDLP 59 >AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. Length = 133 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 199 LLRKHIRYSLPSP 161 LL +HI+Y +P P Sbjct: 82 LLHEHIKYDVPKP 94 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 22.2 bits (45), Expect = 5.2 Identities = 11/41 (26%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -3 Query: 300 SRHRRFLHFV*CFQ-EYHSGVNRLLHKPGQGKICLCFENIF 181 S+ RR++ + F + H G NR++ + Q + + +E F Sbjct: 522 SQQRRYMLEMDKFVVKLHPGDNRIIRRSDQSSVTIPYERTF 562 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 21.4 bits (43), Expect = 9.1 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -1 Query: 224 SLVKEKYAFASKTYSIFLTISVRISVFNTTKHDLEYSL*C 105 SLV A ++T S +LT++V + + H L C Sbjct: 163 SLVVYPLAMIAQTASAYLTLTVTLERYVAVCHPLRARALC 202 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 322,756 Number of Sequences: 2352 Number of extensions: 5806 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 22910151 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -