BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0881.Seq (329 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC119002-1|AAI19003.1| 844|Homo sapiens prickle homolog 2 (Dros... 28 8.0 >BC119002-1|AAI19003.1| 844|Homo sapiens prickle homolog 2 (Drosophila) protein. Length = 844 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = -3 Query: 297 RHRRFLHFV*CFQ-EYHSGVNRLLHKPGQGKICLCFENIF 181 RH HF CF+ E G R + K G+ C CFE+++ Sbjct: 213 RHWHMKHFC-CFECETVLGGQRYIMKEGRPYCCHCFESLY 251 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,433,336 Number of Sequences: 237096 Number of extensions: 780781 Number of successful extensions: 1098 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1098 length of database: 76,859,062 effective HSP length: 79 effective length of database: 58,128,478 effective search space used: 1743854340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -