BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0878.Seq (329 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64842-2|AAB37084.1| 462|Caenorhabditis elegans Hypothetical pr... 28 1.8 U12787-1|AAA92672.1| 458|Caenorhabditis elegans HMG CoA synthas... 28 1.8 U70853-1|AAB09143.2| 439|Caenorhabditis elegans Hypothetical pr... 27 3.2 AF025453-2|AAM98052.1| 225|Caenorhabditis elegans Hypothetical ... 27 3.2 AF025453-1|AAK31407.1| 520|Caenorhabditis elegans Hypothetical ... 27 3.2 AF016417-4|AAB65282.1| 451|Caenorhabditis elegans Hypothetical ... 26 5.5 AF125461-4|AAK18995.1| 1360|Caenorhabditis elegans Hypothetical ... 26 7.3 AF016419-9|AAG24054.1| 2025|Caenorhabditis elegans Hypothetical ... 26 7.3 AF000263-6|AAO21394.1| 496|Caenorhabditis elegans Phenylalanyl ... 26 7.3 AF000263-5|AAG00015.1| 552|Caenorhabditis elegans Phenylalanyl ... 26 7.3 Z68749-6|CAC35818.1| 689|Caenorhabditis elegans Hypothetical pr... 25 9.7 Z68749-5|CAC35817.1| 712|Caenorhabditis elegans Hypothetical pr... 25 9.7 Z68219-7|CAC35827.1| 689|Caenorhabditis elegans Hypothetical pr... 25 9.7 Z68219-6|CAC35826.1| 712|Caenorhabditis elegans Hypothetical pr... 25 9.7 U88184-3|AAK31519.1| 648|Caenorhabditis elegans Hypothetical pr... 25 9.7 AF070477-1|AAC24035.1| 589|Caenorhabditis elegans fibulin-1D pr... 25 9.7 AF051403-2|AAC28323.1| 712|Caenorhabditis elegans fibulin-1 iso... 25 9.7 AF051403-1|AAC28324.1| 689|Caenorhabditis elegans fibulin-1 iso... 25 9.7 AF051402-1|AAC28322.1| 712|Caenorhabditis elegans fibulin-1 iso... 25 9.7 AF051401-1|AAC28321.1| 689|Caenorhabditis elegans fibulin-1 iso... 25 9.7 AB212860-1|BAD98165.1| 712|Caenorhabditis elegans fibulin-1C pr... 25 9.7 >U64842-2|AAB37084.1| 462|Caenorhabditis elegans Hypothetical protein F25B4.6 protein. Length = 462 Score = 27.9 bits (59), Expect = 1.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 135 WSTMSPLTPITVEYPLASNSL 73 W P+TPI EYP+ SL Sbjct: 198 WDFFKPITPIPSEYPVVDGSL 218 >U12787-1|AAA92672.1| 458|Caenorhabditis elegans HMG CoA synthase protein. Length = 458 Score = 27.9 bits (59), Expect = 1.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 135 WSTMSPLTPITVEYPLASNSL 73 W P+TPI EYP+ SL Sbjct: 194 WDFFKPITPIPSEYPVVDGSL 214 >U70853-1|AAB09143.2| 439|Caenorhabditis elegans Hypothetical protein M01H9.2 protein. Length = 439 Score = 27.1 bits (57), Expect = 3.2 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = -2 Query: 262 EALC--ISLDFCVRRPGHSNELYRCLIPSCANNFCIDN 155 E +C ++ D C+ RPG+ +L +C+ CID+ Sbjct: 288 EVICKHVTADTCLSRPGYYLKLCPVTCKNCSGYQCIDS 325 >AF025453-2|AAM98052.1| 225|Caenorhabditis elegans Hypothetical protein C08F1.4b protein. Length = 225 Score = 27.1 bits (57), Expect = 3.2 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 2 KLMRQNNLTENHRSENDTVDV-GDINEFEASGY 97 KLM+ L NH ND+V V D+N F +GY Sbjct: 6 KLMKWEKLVSNHLV-NDSVTVEADLNVFNLAGY 37 >AF025453-1|AAK31407.1| 520|Caenorhabditis elegans Hypothetical protein C08F1.4a protein. Length = 520 Score = 27.1 bits (57), Expect = 3.2 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +2 Query: 2 KLMRQNNLTENHRSENDTVDV-GDINEFEASGY 97 KLM+ L NH ND+V V D+N F +GY Sbjct: 6 KLMKWEKLVSNHLV-NDSVTVEADLNVFNLAGY 37 >AF016417-4|AAB65282.1| 451|Caenorhabditis elegans Hypothetical protein F17A9.5 protein. Length = 451 Score = 26.2 bits (55), Expect = 5.5 Identities = 9/46 (19%), Positives = 26/46 (56%) Frame = +2 Query: 104 VMGVRGDIVDHHKKPYGIIDTKIICATWNKTPVEFIAVSGPPYTEV 241 ++G++ + V+ + + D KI+C + V+F+ ++G + ++ Sbjct: 246 LVGIKTNSVEFQSEGLTLEDAKIMCQVYEDKGVDFVELTGGTFEKL 291 >AF125461-4|AAK18995.1| 1360|Caenorhabditis elegans Hypothetical protein Y8A9A.2 protein. Length = 1360 Score = 25.8 bits (54), Expect = 7.3 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -2 Query: 319 SVDYQIPLCKSVPDSLC*FEALCIS--LDFCVRRPGHSNELYRCLIPSCANNFCIDNTVW 146 SV+ I +C DS C + +S C +P ++ Y P+C +N C + +W Sbjct: 950 SVNCGITVCYFPDDSCCAGYSATVSGTQHICGPQPNYTTP-YAPYDPTCTDNCCPETGIW 1008 >AF016419-9|AAG24054.1| 2025|Caenorhabditis elegans Hypothetical protein F07G11.9 protein. Length = 2025 Score = 25.8 bits (54), Expect = 7.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 285 CQIPFVDSKLFALAWTSV*GGPDTAMN 205 C IP+V SK + WT + G D+ N Sbjct: 8 CLIPWVSSKAYCTKWTEIKSG-DSCWN 33 >AF000263-6|AAO21394.1| 496|Caenorhabditis elegans Phenylalanyl (f) trna synthetaseprotein 1, isoform b protein. Length = 496 Score = 25.8 bits (54), Expect = 7.3 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = +3 Query: 108 WELEETSSTIIRSH-TVLSIQKLF--AQLGIR 194 W++EE ++R+H T +S ++L+ AQ G R Sbjct: 314 WKIEEAQKNVLRTHTTAVSARQLYQLAQEGFR 345 >AF000263-5|AAG00015.1| 552|Caenorhabditis elegans Phenylalanyl (f) trna synthetaseprotein 1, isoform a protein. Length = 552 Score = 25.8 bits (54), Expect = 7.3 Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 3/32 (9%) Frame = +3 Query: 108 WELEETSSTIIRSH-TVLSIQKLF--AQLGIR 194 W++EE ++R+H T +S ++L+ AQ G R Sbjct: 370 WKIEEAQKNVLRTHTTAVSARQLYQLAQEGFR 401 >Z68749-6|CAC35818.1| 689|Caenorhabditis elegans Hypothetical protein F56H11.1b protein. Length = 689 Score = 25.4 bits (53), Expect = 9.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 253 CISLDFCVRRPGHSNELYRCLIPSCANNFCIDNTVWLLMMVDDVSSNSHYC 101 C+ C+ PG S + R L SC + +D+ VD+ + SH C Sbjct: 206 CLESQRCLNTPG-SFKCIRTL--SCGTGYAMDSETERCRDVDECNLGSHDC 253 >Z68749-5|CAC35817.1| 712|Caenorhabditis elegans Hypothetical protein F56H11.1a protein. Length = 712 Score = 25.4 bits (53), Expect = 9.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 253 CISLDFCVRRPGHSNELYRCLIPSCANNFCIDNTVWLLMMVDDVSSNSHYC 101 C+ C+ PG S + R L SC + +D+ VD+ + SH C Sbjct: 206 CLESQRCLNTPG-SFKCIRTL--SCGTGYAMDSETERCRDVDECNLGSHDC 253 >Z68219-7|CAC35827.1| 689|Caenorhabditis elegans Hypothetical protein F56H11.1b protein. Length = 689 Score = 25.4 bits (53), Expect = 9.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 253 CISLDFCVRRPGHSNELYRCLIPSCANNFCIDNTVWLLMMVDDVSSNSHYC 101 C+ C+ PG S + R L SC + +D+ VD+ + SH C Sbjct: 206 CLESQRCLNTPG-SFKCIRTL--SCGTGYAMDSETERCRDVDECNLGSHDC 253 >Z68219-6|CAC35826.1| 712|Caenorhabditis elegans Hypothetical protein F56H11.1a protein. Length = 712 Score = 25.4 bits (53), Expect = 9.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 253 CISLDFCVRRPGHSNELYRCLIPSCANNFCIDNTVWLLMMVDDVSSNSHYC 101 C+ C+ PG S + R L SC + +D+ VD+ + SH C Sbjct: 206 CLESQRCLNTPG-SFKCIRTL--SCGTGYAMDSETERCRDVDECNLGSHDC 253 >U88184-3|AAK31519.1| 648|Caenorhabditis elegans Hypothetical protein F36H5.8 protein. Length = 648 Score = 25.4 bits (53), Expect = 9.7 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +2 Query: 23 LTENHRSENDTVDVGDINEFEASG-YSTVMGV 115 LT NHR V+ GD E + G Y +++G+ Sbjct: 432 LTNNHRLNKLIVEAGDNQEIDMDGFYRSLIGL 463 >AF070477-1|AAC24035.1| 589|Caenorhabditis elegans fibulin-1D precursor protein. Length = 589 Score = 25.4 bits (53), Expect = 9.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 253 CISLDFCVRRPGHSNELYRCLIPSCANNFCIDNTVWLLMMVDDVSSNSHYC 101 C+ C+ PG S + R L SC + +D+ VD+ + SH C Sbjct: 106 CLESQRCLNTPG-SFKCIRTL--SCGTGYAMDSETERCRDVDECNLGSHDC 153 >AF051403-2|AAC28323.1| 712|Caenorhabditis elegans fibulin-1 isoform C precursor protein. Length = 712 Score = 25.4 bits (53), Expect = 9.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 253 CISLDFCVRRPGHSNELYRCLIPSCANNFCIDNTVWLLMMVDDVSSNSHYC 101 C+ C+ PG S + R L SC + +D+ VD+ + SH C Sbjct: 206 CLESQRCLNTPG-SFKCIRTL--SCGTGYAMDSETERCRDVDECNLGSHDC 253 >AF051403-1|AAC28324.1| 689|Caenorhabditis elegans fibulin-1 isoform D precursor protein. Length = 689 Score = 25.4 bits (53), Expect = 9.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 253 CISLDFCVRRPGHSNELYRCLIPSCANNFCIDNTVWLLMMVDDVSSNSHYC 101 C+ C+ PG S + R L SC + +D+ VD+ + SH C Sbjct: 206 CLESQRCLNTPG-SFKCIRTL--SCGTGYAMDSETERCRDVDECNLGSHDC 253 >AF051402-1|AAC28322.1| 712|Caenorhabditis elegans fibulin-1 isoform C precursor protein. Length = 712 Score = 25.4 bits (53), Expect = 9.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 253 CISLDFCVRRPGHSNELYRCLIPSCANNFCIDNTVWLLMMVDDVSSNSHYC 101 C+ C+ PG S + R L SC + +D+ VD+ + SH C Sbjct: 206 CLESQRCLNTPG-SFKCIRTL--SCGTGYAMDSETERCRDVDECNLGSHDC 253 >AF051401-1|AAC28321.1| 689|Caenorhabditis elegans fibulin-1 isoform D precursor protein. Length = 689 Score = 25.4 bits (53), Expect = 9.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 253 CISLDFCVRRPGHSNELYRCLIPSCANNFCIDNTVWLLMMVDDVSSNSHYC 101 C+ C+ PG S + R L SC + +D+ VD+ + SH C Sbjct: 206 CLESQRCLNTPG-SFKCIRTL--SCGTGYAMDSETERCRDVDECNLGSHDC 253 >AB212860-1|BAD98165.1| 712|Caenorhabditis elegans fibulin-1C protein. Length = 712 Score = 25.4 bits (53), Expect = 9.7 Identities = 15/51 (29%), Positives = 23/51 (45%) Frame = -2 Query: 253 CISLDFCVRRPGHSNELYRCLIPSCANNFCIDNTVWLLMMVDDVSSNSHYC 101 C+ C+ PG S + R L SC + +D+ VD+ + SH C Sbjct: 206 CLESQRCLNTPG-SFKCIRTL--SCGTGYAMDSETERCRDVDECNLGSHDC 253 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,207,950 Number of Sequences: 27780 Number of extensions: 139990 Number of successful extensions: 430 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 12,740,198 effective HSP length: 72 effective length of database: 10,740,038 effective search space used: 397381406 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -