BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0873.Seq (269 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31G5.15 |||phosphatidylserine decarboxylase |Schizosaccharom... 25 1.9 SPBC1734.11 |||DNAJ domain protein Mas5 |Schizosaccharomyces pom... 23 5.7 SPBC14F5.05c |sam1||S-adenosylmethionine synthetase |Schizosacch... 23 7.5 SPAC21E11.08 |lcb2|SPAC2C4.02|serine palmitoyltransferase |Schiz... 23 7.5 SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gc... 23 7.5 SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces po... 23 9.9 SPBC1271.04c |||deoxyhypusine synthase|Schizosaccharomyces pombe... 23 9.9 >SPAC31G5.15 |||phosphatidylserine decarboxylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 980 Score = 25.0 bits (52), Expect = 1.9 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -2 Query: 100 CREA-VMRFGLKGGAAVVTIWVAHLCC 23 CR A +R G+K G ++ I V +CC Sbjct: 7 CRSANTLRKGIKNGKLILKIIVNDVCC 33 >SPBC1734.11 |||DNAJ domain protein Mas5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 407 Score = 23.4 bits (48), Expect = 5.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 114 GGGTYPRGLTRGPTTSKINHINTIRFPL 197 GGG + G+ RGP K + ++TI+ L Sbjct: 92 GGGMFGGGMPRGPRKGK-DLVHTIKVTL 118 >SPBC14F5.05c |sam1||S-adenosylmethionine synthetase |Schizosaccharomyces pombe|chr 2|||Manual Length = 382 Score = 23.0 bits (47), Expect = 7.5 Identities = 8/26 (30%), Positives = 13/26 (50%) Frame = +1 Query: 64 RPSNRNALLLHGRNRQGAVVPTRADS 141 RP + + + GAV+P R D+ Sbjct: 164 RPDTKTQVTIEYEEENGAVIPRRVDT 189 >SPAC21E11.08 |lcb2|SPAC2C4.02|serine palmitoyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 603 Score = 23.0 bits (47), Expect = 7.5 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 50 YNGCPALQTETHYCFTA 100 Y CP L + +CF+A Sbjct: 517 YPACPLLTSRVRFCFSA 533 >SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gcn2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1576 Score = 23.0 bits (47), Expect = 7.5 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 45 YGWHIYVVDVYS 10 YGW +YV+ YS Sbjct: 320 YGWRLYVLQEYS 331 >SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1396 Score = 22.6 bits (46), Expect = 9.9 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -2 Query: 124 VPPPPAYFCREAVMRFGLKGGAAVVTIWVAHLCCR 20 V PPP Y C E F G +V A+ C+ Sbjct: 1301 VDPPPNYSCGEYFSSFLNSSGHGIVYNPEAYSSCQ 1335 >SPBC1271.04c |||deoxyhypusine synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 22.6 bits (46), Expect = 9.9 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = +3 Query: 21 LQHKCATHIVTTA 59 +QHKC IVTTA Sbjct: 111 VQHKCVDVIVTTA 123 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,013,272 Number of Sequences: 5004 Number of extensions: 16520 Number of successful extensions: 30 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 2,362,478 effective HSP length: 61 effective length of database: 2,057,234 effective search space used: 57602552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -