BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0872.Seq (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter... 22 4.0 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 6.9 >AF144379-1|AAD34586.1| 543|Apis mellifera glutamate transporter Am-EAAT protein. Length = 543 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/31 (25%), Positives = 16/31 (51%) Frame = -2 Query: 495 FFSYILPAWVASFGVSLLLTSLDVFKSCLRQ 403 FF ++ AW+ + G + +L + CL + Sbjct: 346 FFRGMMQAWMTALGTASSAATLPITFRCLEE 376 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 123 LFCVVTDYYKFFC 85 LF ++ YYK FC Sbjct: 215 LFVMIQVYYKIFC 227 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,108 Number of Sequences: 438 Number of extensions: 3162 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -