BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0869.Seq (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccha... 30 0.17 SPBC16H5.13 |||WD repeat protein |Schizosaccharomyces pombe|chr ... 29 0.39 SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 8.4 SPBC11B10.07c |||CDC50 domain protein|Schizosaccharomyces pombe|... 25 8.4 >SPBC609.03 |||WD repeat protein, human IQWD1 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 809 Score = 30.3 bits (65), Expect = 0.17 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 57 NTPVTIYYGHCAFFFSNLQSVKGMNFF 137 NT V YYGHC N++S+K +NF+ Sbjct: 658 NTHVKSYYGHC-----NVESIKNVNFY 679 >SPBC16H5.13 |||WD repeat protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1026 Score = 29.1 bits (62), Expect = 0.39 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +3 Query: 57 NTPVTIYYGHCAFFFSNLQSVKGMNFFDIY*MLLNINY 170 N P T+Y+G CA NL +V F D + ++LN+N+ Sbjct: 525 NLP-TLYHGSCALLTDNLVTV----FLDAHDLVLNLNF 557 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 24.6 bits (51), Expect = 8.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 305 FFFYLNIFSIFS*LCT 258 FFFY ++FS FS L T Sbjct: 110 FFFYFSLFSFFSFLFT 125 >SPBC11B10.07c |||CDC50 domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 371 Score = 24.6 bits (51), Expect = 8.4 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 57 NTPVTIYYGHCAFFFSNLQSVKGMNFF 137 N PVT Y G FS + G N+F Sbjct: 301 NFPVTEYKGTKTIMFSTTSVIGGKNYF 327 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,713,081 Number of Sequences: 5004 Number of extensions: 30250 Number of successful extensions: 38 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -