BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0868.Seq (499 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 25 0.44 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 3.1 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 3.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.1 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 25.0 bits (52), Expect = 0.44 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +3 Query: 387 KCICITSSLVGGKTTPAALTLRRPQLRGIELDAESL 494 K +CI ++ VGG++ LT+ P IE +++ Sbjct: 284 KYLCIVNNSVGGESVETVLTVTAPLGAEIEPSTQTI 319 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 3.1 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -1 Query: 442 SAAGVVLPPTKDDVMHMHFIGRQR*R*KPSYLY 344 ++ G V PPTK + FI Q +Y Y Sbjct: 112 ASPGYVQPPTKHQKLDQKFIFPQENNYNDNYFY 144 Score = 21.4 bits (43), Expect = 5.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 310 ILKGSFLTHWI*SLSQNLKGYKKG 239 I KGSF+T ++ + N + K+G Sbjct: 516 IKKGSFVTQYVGEVITNEEAEKRG 539 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 417 GGKTTPAALTLRRP 458 GG TTPA+ TL P Sbjct: 21 GGSTTPASPTLSTP 34 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 4.1 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -2 Query: 144 LSEKGHLSAPLNKVTNAEIAEEMAYCYARMKSDILE 37 L++ S PL V N E + Y Y SD+ E Sbjct: 299 LAKMEKTSKPLPMVDNPESTGNLVYIYNNPFSDVEE 334 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,244 Number of Sequences: 438 Number of extensions: 3073 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -