BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0867.Seq (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0101 + 16659185-16660546 28 3.6 04_04_0170 - 23268714-23268950,23269040-23269303,23269379-232694... 28 4.8 02_04_0440 + 22954950-22955213,22955317-22956621,22956791-22957522 27 6.3 >06_03_0101 + 16659185-16660546 Length = 453 Score = 28.3 bits (60), Expect = 3.6 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = -1 Query: 436 RETHELIIRFIYXHGSRATVDLI*MLFLFVLLCDV 332 R+TH L + I G+R T+ + L+ +LLCDV Sbjct: 200 RQTHHLTAKVITLRGARGTIGWV-DLWRGILLCDV 233 >04_04_0170 - 23268714-23268950,23269040-23269303,23269379-23269494, 23269574-23269792,23269961-23270080,23270170-23270283, 23271870-23271946,23272527-23272657 Length = 425 Score = 27.9 bits (59), Expect = 4.8 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = +2 Query: 161 SISCD----GYNIKRSTK*SPILSTSVKHVLVRCNYLCLRNV 274 SISC +N+KRS K + + SV++ V C +C + + Sbjct: 88 SISCHLRRRAHNLKRSKKDIEVTAVSVEYEEVTCKQMCTKEI 129 >02_04_0440 + 22954950-22955213,22955317-22956621,22956791-22957522 Length = 766 Score = 27.5 bits (58), Expect = 6.3 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = +2 Query: 326 DADVTKEHEQKQHLN*VNSRTRSV-XIDEADNQF---MCLSLSLALVSEC 463 DAD +H++++ L+ V+ T ++ +DE +N F +C SL L C Sbjct: 600 DADQEAQHQEEEELHMVDDATMTLEPMDEENNDFNNVICPCPSLELEEHC 649 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,229,811 Number of Sequences: 37544 Number of extensions: 133061 Number of successful extensions: 193 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -