BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0866.Seq (499 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8ILR9 Cluster: Putative uncharacterized protein; n=1; ... 36 0.67 UniRef50_Q04FV9 Cluster: Putative uncharacterized protein; n=2; ... 35 0.88 UniRef50_Q54BW4 Cluster: Ras GTPase domain-containing protein; n... 34 2.0 UniRef50_A0UVP7 Cluster: Putative uncharacterized protein; n=1; ... 33 2.7 UniRef50_Q9APY1 Cluster: Paraquat-inducible protein A; n=12; Pse... 33 3.6 >UniRef50_Q8ILR9 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 4662 Score = 35.5 bits (78), Expect = 0.67 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = -2 Query: 489 SYLSISLTV*YSLXFTINYVVAKFHYLYQKLLYY--YIDYIIETFATIGMLSCFFFLNQ* 316 +YL+++L + Y I ++ F YLY +YY YI YI+ T+ + + + F + + Sbjct: 128 TYLNVTLNINYVFLQIIYNIILYFVYLY---IYYTKYIYYILRTYLFLLLYNSFHIIREN 184 Query: 315 CY 310 CY Sbjct: 185 CY 186 >UniRef50_Q04FV9 Cluster: Putative uncharacterized protein; n=2; Oenococcus oeni|Rep: Putative uncharacterized protein - Oenococcus oeni (strain BAA-331 / PSU-1) Length = 135 Score = 35.1 bits (77), Expect = 0.88 Identities = 24/83 (28%), Positives = 45/83 (54%) Frame = +1 Query: 145 YSQKRIHYIVAKTIGMSLRIFNMQQHKPQSLRNKVMIYFSISNS*TDSLFSTFRIITLLI 324 + +K + ++A I ++LRI NM+ H P S N ++ S+ + ++ + ++II + I Sbjct: 13 FFKKTVIAVIAMYIALALRIDNME-HFPISGDNVLVTKISVLIAVFVAILNAYQIICVFI 71 Query: 325 QKKKTR*HPYCSECFNNVVYIII 393 + +T Y S CF + III Sbjct: 72 ELNQTFKIIYLSSCFLSNASIII 94 >UniRef50_Q54BW4 Cluster: Ras GTPase domain-containing protein; n=4; Eukaryota|Rep: Ras GTPase domain-containing protein - Dictyostelium discoideum AX4 Length = 3933 Score = 33.9 bits (74), Expect = 2.0 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -1 Query: 472 SNCIIFTAIYDKLCRGKISLFIPKTTVLLYRLHY*NIRYNRDVI 341 +NC+ F + YDKL R ++ + +TT ++ R RYN DV+ Sbjct: 3583 NNCLYFNSYYDKLIRSQLFHSLERTTAIIAR-SLIQSRYNIDVV 3625 >UniRef50_A0UVP7 Cluster: Putative uncharacterized protein; n=1; Clostridium cellulolyticum H10|Rep: Putative uncharacterized protein - Clostridium cellulolyticum H10 Length = 89 Score = 33.5 bits (73), Expect = 2.7 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -2 Query: 174 DYVMYSFLGIVCTLLMLFCVFFFKLNYRARLIR 76 D ++Y +G+V T ++F ++F KLN LIR Sbjct: 6 DIILYGSIGVVSTAPLIFIIYFHKLNLLFELIR 38 >UniRef50_Q9APY1 Cluster: Paraquat-inducible protein A; n=12; Pseudomonadaceae|Rep: Paraquat-inducible protein A - Pseudomonas aeruginosa Length = 237 Score = 33.1 bits (72), Expect = 3.6 Identities = 10/27 (37%), Positives = 22/27 (81%) Frame = +1 Query: 178 KTIGMSLRIFNMQQHKPQSLRNKVMIY 258 K +G++L ++++Q+H+P S R ++M+Y Sbjct: 140 KLVGIALLLYSVQRHQPMSARQRIMMY 166 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 440,598,974 Number of Sequences: 1657284 Number of extensions: 8138415 Number of successful extensions: 18063 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18040 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29273652170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -