BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0804.Seq (398 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y14366-1|CAA74736.1| 433|Drosophila melanogaster lipase 1 protein. 27 9.2 AY075506-1|AAL68315.1| 439|Drosophila melanogaster RE54405p pro... 27 9.2 AE014134-1935|AAF52994.1| 439|Drosophila melanogaster CG7279-PA... 27 9.2 >Y14366-1|CAA74736.1| 433|Drosophila melanogaster lipase 1 protein. Length = 433 Score = 27.1 bits (57), Expect = 9.2 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = +1 Query: 160 INHYLGVLKTNKIEPRSYSIIPCTEIFKQHFYP 258 + H++ ++K+ + P SYS ++++ H P Sbjct: 305 VKHFIQIIKSGRFAPYSYSSNKNMQLYRDHLPP 337 >AY075506-1|AAL68315.1| 439|Drosophila melanogaster RE54405p protein. Length = 439 Score = 27.1 bits (57), Expect = 9.2 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = +1 Query: 160 INHYLGVLKTNKIEPRSYSIIPCTEIFKQHFYP 258 + H++ ++K+ + P SYS ++++ H P Sbjct: 311 VKHFIQIIKSGRFAPYSYSSNKNMQLYRDHLPP 343 >AE014134-1935|AAF52994.1| 439|Drosophila melanogaster CG7279-PA protein. Length = 439 Score = 27.1 bits (57), Expect = 9.2 Identities = 8/33 (24%), Positives = 19/33 (57%) Frame = +1 Query: 160 INHYLGVLKTNKIEPRSYSIIPCTEIFKQHFYP 258 + H++ ++K+ + P SYS ++++ H P Sbjct: 311 VKHFIQIIKSGRFAPYSYSSNKNMQLYRDHLPP 343 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,045,064 Number of Sequences: 53049 Number of extensions: 207004 Number of successful extensions: 297 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 297 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1149697725 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -