BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0802.Seq (422 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 0.92 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 22 2.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 3.7 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 3.7 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 3.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 3.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 3.7 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 3.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 3.7 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 3.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 3.7 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 21 6.5 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.4 bits (48), Expect = 0.92 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 394 RTPMFIVKAYLPVNESFGFT 335 R P F P+N SF FT Sbjct: 627 RAPTFTALGLFPINGSFAFT 646 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 22.2 bits (45), Expect = 2.1 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = -3 Query: 369 PTYLSMSRSVLLPICVPTPADRPSRSAYSTIGRSSLETLRTSEQALQRCTGNEKEE 202 PT + +L+PI T + S S YS E++R ++RC +E+ Sbjct: 189 PTQGASPLPLLVPIPQRTASTASSASNYSPSQSPEPESVRPLSLVVRRCEEPTEEK 244 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 3.7 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = -1 Query: 335 CRFAFQHRRTGLPAVRIRPLAGPPWRPCEPQSKPYNVVQETRKRKGLKEGL 183 C++A TG+ + + G P R P S P N K GL L Sbjct: 99 CKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSN--SNATKSSGLTSPL 147 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 3.7 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = -1 Query: 335 CRFAFQHRRTGLPAVRIRPLAGPPWRPCEPQSKPYNVVQETRKRKGLKEGL 183 C++A TG+ + + G P R P S P N K GL L Sbjct: 99 CKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSN--SNATKSSGLTSPL 147 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.4 bits (43), Expect = 3.7 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = -1 Query: 335 CRFAFQHRRTGLPAVRIRPLAGPPWRPCEPQSKPYNVVQETRKRKGLKEGL 183 C++A TG+ + + G P R P S P N K GL L Sbjct: 99 CKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSN--SNATKSSGLTSPL 147 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.4 bits (43), Expect = 3.7 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = -1 Query: 335 CRFAFQHRRTGLPAVRIRPLAGPPWRPCEPQSKPYNVVQETRKRKGLKEGL 183 C++A TG+ + + G P R P S P N K GL L Sbjct: 99 CKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSN--SNATKSSGLTSPL 147 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.4 bits (43), Expect = 3.7 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = -1 Query: 335 CRFAFQHRRTGLPAVRIRPLAGPPWRPCEPQSKPYNVVQETRKRKGLKEGL 183 C++A TG+ + + G P R P S P N K GL L Sbjct: 99 CKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSN--SNATKSSGLTSPL 147 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.4 bits (43), Expect = 3.7 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = -1 Query: 335 CRFAFQHRRTGLPAVRIRPLAGPPWRPCEPQSKPYNVVQETRKRKGLKEGL 183 C++A TG+ + + G P R P S P N K GL L Sbjct: 55 CKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSN--SNATKSSGLTSPL 103 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 3.7 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = -1 Query: 335 CRFAFQHRRTGLPAVRIRPLAGPPWRPCEPQSKPYNVVQETRKRKGLKEGL 183 C++A TG+ + + G P R P S P N K GL L Sbjct: 99 CKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSN--SNATKSSGLTSPL 147 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.4 bits (43), Expect = 3.7 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = -1 Query: 335 CRFAFQHRRTGLPAVRIRPLAGPPWRPCEPQSKPYNVVQETRKRKGLKEGL 183 C++A TG+ + + G P R P S P N K GL L Sbjct: 99 CKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSN--SNATKSSGLTSPL 147 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.4 bits (43), Expect = 3.7 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = -1 Query: 335 CRFAFQHRRTGLPAVRIRPLAGPPWRPCEPQSKPYNVVQETRKRKGLKEGL 183 C++A TG+ + + G P R P S P N K GL L Sbjct: 99 CKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSN--SNATKSSGLTSPL 147 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 20.6 bits (41), Expect = 6.5 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +3 Query: 255 GSPGRTCQWSNTHC 296 G G+TC ++HC Sbjct: 135 GWKGKTCSLKDSHC 148 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,367 Number of Sequences: 336 Number of extensions: 2102 Number of successful extensions: 12 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9384961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -