BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0799.Seq (436 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 25 1.5 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 25 1.5 AY146739-1|AAO12099.1| 176|Anopheles gambiae odorant-binding pr... 23 4.7 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 24.6 bits (51), Expect = 1.5 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -2 Query: 303 NRRFLERRLTD--DMLRKLSVSPRMRCTDSAAHKCNYELFNRNN 178 NR + ++ D D +RK++ + R S A+ Y +++RNN Sbjct: 322 NRIIITPKINDAADQIRKVAQAQRQCVFASEANLSYYSVYSRNN 365 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 24.6 bits (51), Expect = 1.5 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 2/44 (4%) Frame = -2 Query: 303 NRRFLERRLTD--DMLRKLSVSPRMRCTDSAAHKCNYELFNRNN 178 NR + ++ D D +RK++ + R S A+ Y +++RNN Sbjct: 322 NRIIITPKINDAADQIRKVAQAQRQCVFASEANLSYYSVYSRNN 365 >AY146739-1|AAO12099.1| 176|Anopheles gambiae odorant-binding protein AgamOBP29 protein. Length = 176 Score = 23.0 bits (47), Expect = 4.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 216 PRCRCTASAVILTVCGA 266 P+ RC + AV + +CGA Sbjct: 6 PQKRCVSRAVTVGICGA 22 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 441,452 Number of Sequences: 2352 Number of extensions: 7884 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36142935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -