BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0794.Seq (435 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizo... 33 0.025 SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 comple... 28 0.54 SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk... 26 2.9 SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces ... 25 3.8 SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 25 5.0 SPAC6G9.13c |bqt1|mug23, rec26|bouquet formation protein Bqt1|Sc... 25 6.7 >SPCC1494.05c |ubp12||ubiquitin C-terminal hydrolase Ubp12|Schizosaccharomyces pombe|chr 3|||Manual Length = 979 Score = 32.7 bits (71), Expect = 0.025 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +3 Query: 222 ASEVVNFDESGNFCRSHGQVPATHLSNVCLINFRW*F---LRLPWLSRVTGNQGSIPERE 392 + E+++F E G + L C+IN W LRL +L + NQ S E++ Sbjct: 243 SKEIIDFLEKSKTLVELGMDSSCSLVAECMINETWPVDRALRLQFLIQQRNNQSSNEEQK 302 Query: 393 PEKRLP 410 EKR+P Sbjct: 303 QEKRVP 308 >SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 442 Score = 28.3 bits (60), Expect = 0.54 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -1 Query: 282 VLDHAICKSFQIHQN*RLRTRGPPSIGFDLIKALIP 175 ++D K + IH + L + PS GF +I++L+P Sbjct: 391 LIDQGYIKGYIIHASSTLVLKKDPSFGFSVIESLMP 426 >SPAC1D4.06c |csk1||cyclin-dependent kinase activating kinase Csk1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 306 Score = 25.8 bits (54), Expect = 2.9 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -2 Query: 419 PWMW*PFLRLPLRNRTLIPRYP*QPW*SQKLPS 321 P MW P N+ + YP +PW S+ LPS Sbjct: 236 PSMWPELSTFPDWNKFIFHEYPPKPW-SEILPS 267 >SPBC30D10.17c |||glucan synthase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 504 Score = 25.4 bits (53), Expect = 3.8 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 417 LDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 316 L ++ S+ P + PD P T+ V+ TT+E+ Sbjct: 422 LGLINTSEINQPANLPDEPTAETSNPVSATTVEA 455 >SPAC1071.03c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 25.0 bits (52), Expect = 5.0 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 71 NGSIYQFWFLRSYSVTWITVVILELIHAIRTLTSD 175 N IY+ +F ++S++ + + I L +RT++SD Sbjct: 14 NTQIYRIFFTLTFSLSNLFLAICYLFLNVRTVSSD 48 >SPAC6G9.13c |bqt1|mug23, rec26|bouquet formation protein Bqt1|Schizosaccharomyces pombe|chr 1|||Manual Length = 132 Score = 24.6 bits (51), Expect = 6.7 Identities = 14/53 (26%), Positives = 21/53 (39%) Frame = +3 Query: 213 EGLASEVVNFDESGNFCRSHGQVPATHLSNVCLINFRW*FLRLPWLSRVTGNQ 371 E L S N + C+ + H+ NF+ + LPW R+ G Q Sbjct: 55 EYLYSIFPNIWQFALLCQGQNKESLIHMEEDASTNFKLRYYVLPWSRRLQGYQ 107 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,801,343 Number of Sequences: 5004 Number of extensions: 34189 Number of successful extensions: 71 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 68 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 156095170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -