SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0794.Seq
         (435 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-3155|AAF53840.1| 3781|Drosophila melanogaster CG10631-P...    27   8.3  

>AE014134-3155|AAF53840.1| 3781|Drosophila melanogaster CG10631-PA
            protein.
          Length = 3781

 Score = 27.5 bits (58), Expect = 8.3
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 2/59 (3%)
 Frame = -1

Query: 396  QAPSPE--SNPDSPLPVTTMVVAETTIES**GRHLKDASPVLDHAICKSFQIHQN*RLR 226
            QAPS E    PD PLP+ T  +A+         H   + P L    C++ ++    R R
Sbjct: 3603 QAPSDEVKRKPDPPLPIATCCMADCHHNGNVKLHKFPSDPALLRQWCQALRLTDTQRYR 3661


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,661,258
Number of Sequences: 53049
Number of extensions: 384495
Number of successful extensions: 1127
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1090
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1126
length of database: 24,988,368
effective HSP length: 78
effective length of database: 20,850,546
effective search space used: 1376136036
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -