BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0786.Seq (424 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283268-1|AAG15373.1| 46|Anopheles gambiae ribosomal protein ... 65 1e-12 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 24 2.6 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 23 6.0 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 6.0 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 22 8.0 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 22 8.0 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 22 8.0 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 22 8.0 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 22 8.0 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 22 8.0 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 22 8.0 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 22 8.0 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 22 8.0 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 22 8.0 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 22 8.0 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 22 8.0 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 22 8.0 >AF283268-1|AAG15373.1| 46|Anopheles gambiae ribosomal protein S18 protein. Length = 46 Score = 64.9 bits (151), Expect = 1e-12 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 166 LREDLERLKKIRAHRGMRHYWGLRVRGQH 80 LREDLERLK+I AHRGMRHYWGLRVRGQH Sbjct: 1 LREDLERLKRIHAHRGMRHYWGLRVRGQH 29 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 23.8 bits (49), Expect = 2.6 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -2 Query: 366 YSNIVLKKADIDLDKRAGECTEEEV 292 Y+ IVL +A + LDK +C + + Sbjct: 534 YAYIVLVQAVLPLDKNLNDCNRQSI 558 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 22.6 bits (46), Expect = 6.0 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = -1 Query: 208 GKYSQLTSSNLDSKLREDLERLKKIRAHRG 119 G+Y +LT ++L ++ R+D L +I+ G Sbjct: 63 GRYYELTGADLFARWRQDYGDLIRIKGMFG 92 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/33 (33%), Positives = 14/33 (42%) Frame = -1 Query: 394 CGYQRCWPEVLQHCSQKSRH*S*QACWRMHRRR 296 C +CW EVLQ R + + HR R Sbjct: 953 CNVGKCWSEVLQSADFAKRREAVEKFNEEHRWR 985 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 213 IAHSTSSIVHGPSHLS 228 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 212 IAHSTSSIVHGPSHLS 227 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 212 IAHSTSSIVHGPSHLS 227 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 215 IAHSTSSIVHGPSHLS 230 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 220 IAHSTSSIVHGPSHLS 235 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 212 IAHSTSSIVHGPSHLS 227 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 220 IAHSTSSIVHGPSHLS 235 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 244 IAHSTSSIVHGPSHLS 259 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 212 IAHSTSSIVHGPSHLS 227 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 213 IAHSTSSIVHGPSHLS 228 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 212 IAHSTSSIVHGPSHLS 227 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 220 IAHSTSSIVHGPSHLS 235 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 281 IIFSTSSSVHSPARLS 328 I STSS VH P+ LS Sbjct: 212 IAHSTSSIVHGPSHLS 227 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 424,003 Number of Sequences: 2352 Number of extensions: 8043 Number of successful extensions: 23 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -