BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0784.Seq (433 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3B8.04c |||membrane transporter|Schizosaccharomyces pombe|ch... 25 6.6 SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces po... 25 6.6 SPCC63.11 |prp28||U5 snRNP-associated protein Prp28 |Schizosacch... 24 8.7 >SPBC3B8.04c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 867 Score = 24.6 bits (51), Expect = 6.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 351 RYFTXQDYWDAGIPARLXSVTVRL 422 RY D+ AGIPA L S + L Sbjct: 832 RYLKVSDFLKAGIPATLISFVILL 855 >SPBC16G5.12c |top3||DNA topoisomerase III|Schizosaccharomyces pombe|chr 2|||Manual Length = 622 Score = 24.6 bits (51), Expect = 6.6 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +1 Query: 205 SFNIDNIKHKVALESQIWKKFGEILASTKARPPATRRWSNKIHYPYVRQDILH 363 S N+ I K+ +Q W + E L + RPP + +++ H P ++H Sbjct: 341 SMNLHAIIQKLT-GAQEWDSYAEGLLAGDYRPPRKGKHNDRAHPPIHPVQMVH 392 >SPCC63.11 |prp28||U5 snRNP-associated protein Prp28 |Schizosaccharomyces pombe|chr 3|||Manual Length = 662 Score = 24.2 bits (50), Expect = 8.7 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 3/33 (9%) Frame = +1 Query: 214 IDNIKHKVAL---ESQIWKKFGEILASTKARPP 303 +D ++ +V + +S+ W++ EIL S + PP Sbjct: 486 VDRVEQRVEMISDDSKKWRRVEEILESNRFSPP 518 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,601,552 Number of Sequences: 5004 Number of extensions: 28288 Number of successful extensions: 41 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 154067960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -