BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0784.Seq (433 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC150266-1|AAI50267.1| 1336|Homo sapiens mitogen-activated prote... 29 9.0 AL031717-1|CAM26394.1| 1336|Homo sapiens mitogen-activated prote... 29 9.0 AL031710-1|CAM26364.1| 1336|Homo sapiens mitogen-activated prote... 29 9.0 AE006639-4|AAK61290.1| 1342|Homo sapiens similar to sperm specif... 29 9.0 AB028989-1|BAA83018.2| 1346|Homo sapiens KIAA1066 protein protein. 29 9.0 >BC150266-1|AAI50267.1| 1336|Homo sapiens mitogen-activated protein kinase 8 interacting protein 3 protein. Length = 1336 Score = 28.7 bits (61), Expect = 9.0 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 244 ESQIWKKFGEILASTKARPPATRRW-SNKIHY 336 +S IW+ F + +S+ + PPA R + S IHY Sbjct: 569 KSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHY 600 >AL031717-1|CAM26394.1| 1336|Homo sapiens mitogen-activated protein kinase 8 interacting protein 3 protein. Length = 1336 Score = 28.7 bits (61), Expect = 9.0 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 244 ESQIWKKFGEILASTKARPPATRRW-SNKIHY 336 +S IW+ F + +S+ + PPA R + S IHY Sbjct: 569 KSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHY 600 >AL031710-1|CAM26364.1| 1336|Homo sapiens mitogen-activated protein kinase 8 interacting protein 3 protein. Length = 1336 Score = 28.7 bits (61), Expect = 9.0 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 244 ESQIWKKFGEILASTKARPPATRRW-SNKIHY 336 +S IW+ F + +S+ + PPA R + S IHY Sbjct: 569 KSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHY 600 >AE006639-4|AAK61290.1| 1342|Homo sapiens similar to sperm specifc protein protein. Length = 1342 Score = 28.7 bits (61), Expect = 9.0 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 244 ESQIWKKFGEILASTKARPPATRRW-SNKIHY 336 +S IW+ F + +S+ + PPA R + S IHY Sbjct: 569 KSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHY 600 >AB028989-1|BAA83018.2| 1346|Homo sapiens KIAA1066 protein protein. Length = 1346 Score = 28.7 bits (61), Expect = 9.0 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 244 ESQIWKKFGEILASTKARPPATRRW-SNKIHY 336 +S IW+ F + +S+ + PPA R + S IHY Sbjct: 579 KSTIWQFFSRLFSSSSSPPPAKRPYPSVNIHY 610 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,542,411 Number of Sequences: 237096 Number of extensions: 844495 Number of successful extensions: 4726 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4726 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3430805640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -