BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0783.Seq (436 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK124536-1|BAC85877.1| 170|Homo sapiens PTPRF), interacting pro... 30 4.0 BC063026-1|AAH63026.1| 95|Homo sapiens NDUFB2 protein protein. 29 9.1 AC006344-2|AAD43191.1| 95|Homo sapiens NADH-ubiquinone oxidore... 29 9.1 >AK124536-1|BAC85877.1| 170|Homo sapiens PTPRF), interacting protein (liprin), alpha 2 protein. Length = 170 Score = 29.9 bits (64), Expect = 4.0 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +1 Query: 271 SANVSVSPRMRCTDSAAHKCNYELFNRNNF 360 S +++ PR++C+ + CN+EL +NF Sbjct: 9 SQGLALLPRLKCSGAIIAHCNFELLGSSNF 38 >BC063026-1|AAH63026.1| 95|Homo sapiens NDUFB2 protein protein. Length = 95 Score = 28.7 bits (61), Expect = 9.1 Identities = 18/69 (26%), Positives = 25/69 (36%) Frame = +1 Query: 202 EEHRDRILILNRRFLERRSPTICSANVSVSPRMRCTDSAAHKCNYELFNRNNFSIRYWSW 381 E H + L+L+ E RS V + PR R ++F FS W W Sbjct: 2 ESHERQPLVLHEEMGECRSSLSAGGGVHIEPRYRQFPQLTRS---QVFQSEFFSGLMWFW 58 Query: 382 NYRGCWHQT 408 WH + Sbjct: 59 ILWRFWHDS 67 >AC006344-2|AAD43191.1| 95|Homo sapiens NADH-ubiquinone oxidoreductase AGGG subunit protein. Length = 95 Score = 28.7 bits (61), Expect = 9.1 Identities = 18/69 (26%), Positives = 25/69 (36%) Frame = +1 Query: 202 EEHRDRILILNRRFLERRSPTICSANVSVSPRMRCTDSAAHKCNYELFNRNNFSIRYWSW 381 E H + L+L+ E RS V + PR R ++F FS W W Sbjct: 2 ESHERQPLVLHEEMGECRSSLSAGGGVHIEPRYRQFPQLTRS---QVFQSEFFSGLMWFW 58 Query: 382 NYRGCWHQT 408 WH + Sbjct: 59 ILWRFWHDS 67 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,825,351 Number of Sequences: 237096 Number of extensions: 1091271 Number of successful extensions: 1929 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1929 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3487985734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -