BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0779.Seq (435 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 26 0.21 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 7.9 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 25.8 bits (54), Expect = 0.21 Identities = 12/46 (26%), Positives = 21/46 (45%) Frame = +3 Query: 270 QREQRYPTEDDERDPVEARPHVREAPQQHAELXRVHQVLHQEQSAQ 407 Q + T+ P + + H +A QQH + H + Q+Q +Q Sbjct: 167 QMHHQMHTQHPHMQPQQGQ-HQSQAQQQHLQAHEQHMMYQQQQQSQ 211 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 20.6 bits (41), Expect = 7.9 Identities = 9/43 (20%), Positives = 18/43 (41%) Frame = -2 Query: 305 LIILGWIALFTLPKAYEXXXXXXXXXXXXRAPRSTRSPPRCAP 177 ++++ WIA + P+A A ++T+S P Sbjct: 227 IVVMSWIAFWIKPEAIPARVTLGVTSLLTLATQNTQSQQSLPP 269 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,922 Number of Sequences: 438 Number of extensions: 1231 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -