BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0776.Seq (432 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 27 0.22 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 27 0.22 AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 25 1.2 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 25 1.5 AY994093-1|AAX86006.1| 45|Anopheles gambiae metallothionein 1 ... 24 2.7 U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase... 23 3.5 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 22 8.1 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 22 8.1 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 22 8.1 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 27.5 bits (58), Expect = 0.22 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 273 YKKAKATRKPAKNLIRRPFKAGARRSLYKVKRLLKANHYRTDLCKATL 416 Y++ K +K A + +RP A + L ++K N Y T+ + TL Sbjct: 484 YRRTKQPKKRADSEEKRPRTAFSNAQLQRLKNEFNENRYLTEKRRQTL 531 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 27.5 bits (58), Expect = 0.22 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +3 Query: 273 YKKAKATRKPAKNLIRRPFKAGARRSLYKVKRLLKANHYRTDLCKATL 416 Y++ K +K A + +RP A + L ++K N Y T+ + TL Sbjct: 484 YRRTKQPKKRADSEEKRPRTAFSNAQLQRLKNEFNENRYLTEKRRQTL 531 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 25.0 bits (52), Expect = 1.2 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 67 KPISTPNTTCSQCVR 23 KP +TPN T +CVR Sbjct: 28 KPCTTPNGTAGRCVR 42 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 24.6 bits (51), Expect = 1.5 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +3 Query: 84 VVTELDDHPQQQCIPCEEAQYQKAVQQGAEQCD*PPLLQVQRLDSQ 221 V +L QQQ P ++ Q Q+ QQ + PP L+ QR Q Sbjct: 265 VPPQLRQQRQQQQRPRQQQQQQQQQQQQQGERYVPPQLRQQRQQQQ 310 >AY994093-1|AAX86006.1| 45|Anopheles gambiae metallothionein 1 protein. Length = 45 Score = 23.8 bits (49), Expect = 2.7 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -1 Query: 405 CISLCGSG*PLTTSSLCTVTS 343 C S CGSG P T C S Sbjct: 12 CTSGCGSGQPCATDCKCACAS 32 >U89803-1|AAD03794.1| 250|Anopheles gambiae Tc1-like transposase protein. Length = 250 Score = 23.4 bits (48), Expect = 3.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 397 SVR*WLAFNNLFTLYSDLLAPALN 326 +V+ WLA NN+ T+ L+P LN Sbjct: 163 TVQTWLADNNVKTMKWPALSPDLN 186 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 22.2 bits (45), Expect = 8.1 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +3 Query: 54 VEIGLNRKNVVVTELDDHPQQQ 119 V++ KN+V+ ++ + P+QQ Sbjct: 115 VDVAAELKNMVLQDISNQPKQQ 136 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 22.2 bits (45), Expect = 8.1 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +3 Query: 54 VEIGLNRKNVVVTELDDHPQQQ 119 V++ KN+V+ ++ + P+QQ Sbjct: 116 VDVAAELKNMVLQDISNQPKQQ 137 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 22.2 bits (45), Expect = 8.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 159 ERLFDIALLHKECIVVADDHPVQ*RR 82 ++LFD LHKE + P+ +R Sbjct: 49 DKLFDTIRLHKEVLQTVKLQPISMKR 74 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 453,376 Number of Sequences: 2352 Number of extensions: 9298 Number of successful extensions: 59 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -