Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0774.Seq
         (598 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related pro...    25   0.43 
AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.                22   4.0  
AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor pr...    22   5.3  
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    21   6.9  
AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.    21   6.9  

>DQ015969-1|AAY81926.1|  397|Apis mellifera stargazin related
           protein STG-1 protein.
          Length = 397

 Score = 25.4 bits (53), Expect = 0.43
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 1/64 (1%)
 Frame = -3

Query: 572 VDLLDFCRLQPRE-ARESFQ*CASSLNERWDASSSNGCCQGRSPLSXVDATVPAPPGLRG 396
           +D  D+ R  PR+   ++    A  L E  +  S +   Q       +D  +P PP +RG
Sbjct: 326 LDYHDYSRQFPRDLTTQTVSTTADVLQEEEEEYSPS--VQHEFVTFDLDEPLPPPPPIRG 383

Query: 395 GEHT 384
           GE T
Sbjct: 384 GEWT 387


>AB167961-1|BAD51404.1|  554|Apis mellifera E74 protein.
          Length = 554

 Score = 22.2 bits (45), Expect = 4.0
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +1

Query: 391 SPPRSPGGAGT 423
           SPPR PGG  T
Sbjct: 397 SPPRGPGGVPT 407


>AM076717-1|CAJ28210.1|  501|Apis mellifera serotonin receptor
           protein.
          Length = 501

 Score = 21.8 bits (44), Expect = 5.3
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = +3

Query: 234 QPYCVSKRLVTKPVPNHGVPDV 299
           QP  V+++L +   P HG P V
Sbjct: 259 QPVTVNRQLNSDVQPGHGSPPV 280


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 5/11 (45%), Positives = 10/11 (90%)
 Frame = -1

Query: 592 MPACLVLLISW 560
           +P CL++++SW
Sbjct: 253 IPTCLIVIMSW 263


>AY921579-1|AAX14899.1|  996|Apis mellifera ephrin receptor protein.
          Length = 996

 Score = 21.4 bits (43), Expect = 6.9
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = +2

Query: 347 GQGAFGNMCRG 379
           G G FG++CRG
Sbjct: 640 GGGEFGDVCRG 650


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 159,838
Number of Sequences: 438
Number of extensions: 3082
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 17482179
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)