BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0773.Seq (432 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c... 27 1.2 SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 27 1.2 SPAC19B12.07c |||human ZNF277P homolog|Schizosaccharomyces pombe... 27 1.6 SPCC16A11.08 |atg20||sorting nexin Atg20|Schizosaccharomyces pom... 25 5.0 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 24 8.7 >SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 27.1 bits (57), Expect = 1.2 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 320 LRTPALFFDRCTAPVKLPAWQCLEP 246 LRT +DRC P+K W +EP Sbjct: 53 LRTKFNTYDRCIPPMKKSLWGWIEP 77 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.1 bits (57), Expect = 1.2 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 287 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMF 388 Y+C + +S G L SED ++ W K GLI+ F Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQF 162 >SPAC19B12.07c |||human ZNF277P homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 319 Score = 26.6 bits (56), Expect = 1.6 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 275 KLPAWQCLEPDHAGVLNGDERFRHVTTLHAWN 180 K+ + QCL ++ G+LN E F H +H N Sbjct: 91 KIKSLQCLFCNNEGLLNRQEWFEHSFHVHGLN 122 >SPCC16A11.08 |atg20||sorting nexin Atg20|Schizosaccharomyces pombe|chr 3|||Manual Length = 534 Score = 25.0 bits (52), Expect = 5.0 Identities = 16/58 (27%), Positives = 24/58 (41%) Frame = -3 Query: 313 HLRYSLTDVPPQSNSPPGSVSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAP 140 HLR S+ V S SPP S + + ++ S+ P LG++ D P Sbjct: 169 HLRSSMPLVMANSLSPPSSRALKPIHSLSNPSTASSLEPSSPLGSEDECHPPTSDMQP 226 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 24.2 bits (50), Expect = 8.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 244 SGSRHCQAGSLTGAVHLSKNN 306 SG H + S +G VH+ K+N Sbjct: 276 SGGNHSSSSSSSGKVHVMKDN 296 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,832,537 Number of Sequences: 5004 Number of extensions: 36167 Number of successful extensions: 83 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 154067960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -