BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0773.Seq (432 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 2.6 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 22 3.4 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 22 3.4 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 21 5.9 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 5.9 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 5.9 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 2.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +2 Query: 83 SSLKNHYFHCFITYSVGRK 139 SS +FHC+ GRK Sbjct: 420 SSFFQQFFHCYCPVRFGRK 438 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.8 bits (44), Expect = 3.4 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +2 Query: 62 VGDRFARSSLKNHYFHCFI 118 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.8 bits (44), Expect = 3.4 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +2 Query: 62 VGDRFARSSLKNHYFHCFI 118 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.0 bits (42), Expect = 5.9 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 Query: 341 NLAWSKRAKAGLIQMFKYA*GLRKHGY 421 NLA K+ K MFK L+K Y Sbjct: 448 NLAAEKKDKNSFFNMFKKFASLKKSPY 474 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = -1 Query: 315 DTCVIL*QMYRPSQTPRLAVSRTGSRGSFKRRRAFPPR 202 D CV+ + +P + R G++ + +R PP+ Sbjct: 606 DVCVLKTDTNQSCPSPPVTTKRDGTQETEERLPPLPPK 643 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.0 bits (42), Expect = 5.9 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 Query: 341 NLAWSKRAKAGLIQMFKYA*GLRKHGY 421 NLA K+ K MFK L+K Y Sbjct: 448 NLAAEKKDKNSFFNMFKKFASLKKSPY 474 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,567 Number of Sequences: 438 Number of extensions: 2674 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11244597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -