BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0773.Seq (432 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-... 31 0.25 At4g27520.1 68417.m03952 plastocyanin-like domain-containing pro... 28 3.1 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 28 3.1 At1g67340.1 68414.m07665 zinc finger (MYND type) family protein ... 28 3.1 At5g05360.2 68418.m00577 expressed protein similar to unknown pr... 27 4.1 At5g05360.1 68418.m00578 expressed protein similar to unknown pr... 27 4.1 At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyc... 27 4.1 At3g47910.1 68416.m05224 expressed protein low similarity to non... 27 4.1 At3g55780.1 68416.m06198 glycosyl hydrolase family 17 protein si... 27 5.5 At5g51460.3 68418.m06381 trehalose-6-phosphate phosphatase (TPPA... 27 7.2 At5g51460.2 68418.m06380 trehalose-6-phosphate phosphatase (TPPA... 27 7.2 At5g51460.1 68418.m06379 trehalose-6-phosphate phosphatase (TPPA... 27 7.2 At4g39070.1 68417.m05533 zinc finger (B-box type) family protein... 27 7.2 At4g29570.1 68417.m04216 cytidine deaminase, putative / cytidine... 27 7.2 At3g62370.1 68416.m07006 expressed protein 27 7.2 At5g65170.1 68418.m08197 VQ motif-containing protein contains PF... 26 9.6 At5g03450.1 68418.m00300 zinc finger (C3HC4-type RING finger) fa... 26 9.6 At3g48000.1 68416.m05233 aldehyde dehydrogenase (ALDH2) identica... 26 9.6 >At5g39900.1 68418.m04839 GTP-binding protein LepA, putative GTP-binding protein GUF1 - Saccharomyces cerevisiae, PIR:S50374 Length = 661 Score = 31.5 bits (68), Expect = 0.25 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 1/81 (1%) Frame = -3 Query: 280 QSNSPPGSVSNRITREF*TATS-VSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMK 104 Q + P V ++ F T V S LG +H PA +I+R P PP +S ++ Sbjct: 199 QPTADPERVKAQLKSMFDLDTEDVLLVSAKTGLGLEHVLPA-VIERIPPPPG-ISESPLR 256 Query: 103 VVVFQRRSRETISHLCYTSHV 41 +++F E +CY S V Sbjct: 257 MLLFDSFFNEYKGVICYVSVV 277 >At4g27520.1 68417.m03952 plastocyanin-like domain-containing protein similar to PIR|JC7196 phytocyanin-related protein Pn14 {Ipomoea nil}; contains Pfam profile PF02298: Plastocyanin-like domain Length = 349 Score = 27.9 bits (59), Expect = 3.1 Identities = 20/61 (32%), Positives = 27/61 (44%) Frame = -3 Query: 301 SLTDVPPQSNSPPGSVSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRV 122 S T PP S +PPG + + +A S ATSP ++ K +P P PP Sbjct: 169 SPTTSPPGSTTPPGGAHSPKSS---SAVS-PATSPPGSMAPKSGSPVSPTTSPPAPPKST 224 Query: 121 S 119 S Sbjct: 225 S 225 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 27.9 bits (59), Expect = 3.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 151 DRAPLPPNRVSNETMKVVVFQRRSRET 71 +RAPLP V E + + F +R +ET Sbjct: 7 NRAPLPSPNVKKEALSSIPFDKRRKET 33 >At1g67340.1 68414.m07665 zinc finger (MYND type) family protein / F-box family protein Length = 379 Score = 27.9 bits (59), Expect = 3.1 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = -3 Query: 202 SPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETIS 65 S LC LG+ R PAD I+ L R+ M +V R S + I+ Sbjct: 54 SILCKLGSTSRCPADFIN-VLLTCKRLKGLAMNPIVLSRLSPKAIA 98 >At5g05360.2 68418.m00577 expressed protein similar to unknown protein (pir||T02500) Length = 153 Score = 27.5 bits (58), Expect = 4.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 142 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 32 P P+R S V ++ +R+T SHL Y++ V L+ Sbjct: 20 PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56 >At5g05360.1 68418.m00578 expressed protein similar to unknown protein (pir||T02500) Length = 163 Score = 27.5 bits (58), Expect = 4.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 142 PLPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQ 32 P P+R S V ++ +R+T SHL Y++ V L+ Sbjct: 20 PTRPHRPSPSPRNKVFVKKTTRDTTSHLDYSNLVKLE 56 >At4g32420.1 68417.m04615 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein weak similarity to CARS-Cyp [Homo sapiens] GI:1117968; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type Length = 837 Score = 27.5 bits (58), Expect = 4.1 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 282 PSQTPRLAVSRTGSRGSFKRRRAFPPRHHSARLERNTVR 166 P ++PR +VSR+ R S K P R R+ R+ VR Sbjct: 563 PIRSPRKSVSRSPVRSSRKSVSRSPVRSSRRRISRSPVR 601 >At3g47910.1 68416.m05224 expressed protein low similarity to nonmuscle myosin heavy chain (NMHC) [Homo sapiens] GI:189036; contains Pfam profiles PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1290 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 190 TLGTKHRAPADIIDRAPLPPNRVSNETMKVVV 95 T+G+ HR+ AD ++ +PLP V + + +V Sbjct: 972 TIGSDHRSNADSVEHSPLPVAPVGDHSEADIV 1003 >At3g55780.1 68416.m06198 glycosyl hydrolase family 17 protein similar to beta-1,3-glucanase precursor GI:4097948 from [Oryza sativa] Length = 429 Score = 27.1 bits (57), Expect = 5.5 Identities = 11/42 (26%), Positives = 21/42 (50%) Frame = -3 Query: 226 TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNETMKV 101 TA + T+ T+G + PA I L P+R++ + + + Sbjct: 18 TAIATPTTTSATTIGVTYSTPASISGTVQLSPDRIAEKVVSM 59 >At5g51460.3 68418.m06381 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 385 Score = 26.6 bits (56), Expect = 7.2 Identities = 20/60 (33%), Positives = 28/60 (46%) Frame = -3 Query: 328 ELALGHLRYSLTDVPPQSNSPPGSVSNRITREF*TATSVSATSPLCTLGTKHRAPADIID 149 ++ GH +TD PP SNS NR+ AT++S + L L T R I+D Sbjct: 2 DMKSGHSSPVMTDSPPISNSRLTIRQNRLPYSSAAATAISQNNNL--LLTVPRKKTGILD 59 >At5g51460.2 68418.m06380 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 384 Score = 26.6 bits (56), Expect = 7.2 Identities = 20/60 (33%), Positives = 28/60 (46%) Frame = -3 Query: 328 ELALGHLRYSLTDVPPQSNSPPGSVSNRITREF*TATSVSATSPLCTLGTKHRAPADIID 149 ++ GH +TD PP SNS NR+ AT++S + L L T R I+D Sbjct: 2 DMKSGHSSPVMTDSPPISNSRLTIRQNRLPYSSAAATAISQNNNL--LLTVPRKKTGILD 59 >At5g51460.1 68418.m06379 trehalose-6-phosphate phosphatase (TPPA) identical to trehalose-6-phosphate phosphatase (AtTPPA) [Arabidopsis thaliana] GI:2944178 Length = 385 Score = 26.6 bits (56), Expect = 7.2 Identities = 20/60 (33%), Positives = 28/60 (46%) Frame = -3 Query: 328 ELALGHLRYSLTDVPPQSNSPPGSVSNRITREF*TATSVSATSPLCTLGTKHRAPADIID 149 ++ GH +TD PP SNS NR+ AT++S + L L T R I+D Sbjct: 2 DMKSGHSSPVMTDSPPISNSRLTIRQNRLPYSSAAATAISQNNNL--LLTVPRKKTGILD 59 >At4g39070.1 68417.m05533 zinc finger (B-box type) family protein salt-tolerance protein - Arabidopsis thaliana, PID:e224078 Length = 242 Score = 26.6 bits (56), Expect = 7.2 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -3 Query: 379 DQASFCPFAPRXVSVLAELALGHLRYSLTDVPPQSNSP 266 D+A+ C R V +LA HLR+SLT P ++P Sbjct: 20 DEAALCNGCDRHVHFANKLAGKHLRFSLTS-PTFKDAP 56 >At4g29570.1 68417.m04216 cytidine deaminase, putative / cytidine aminohydrolase, putative identical to cytidine deaminase homolog DesA [Arabidopsis thaliana] GI:4836443, cytidine deaminase 8 (CDA8) [Arabidopsis thaliana] GI:5080714; similar to cytidine deaminase (CDD) [Arabidopsis thaliana] GI:3046700; contains Pfam profile PF00383: Cytidine and deoxycytidylate deaminase zinc-binding Length = 293 Score = 26.6 bits (56), Expect = 7.2 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = -3 Query: 394 VLEHLDQASFCPFAPRXVSVLAELALGHLRYSLTDVP 284 +L H++ S+ F P+ +S L A+ H R ++ P Sbjct: 8 MLNHIETESYGAFTPQNLSPLINRAIPHTRAQISGSP 44 >At3g62370.1 68416.m07006 expressed protein Length = 361 Score = 26.6 bits (56), Expect = 7.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 248 PDHAGVLNGDERFRHVTTLHAWN 180 P G NG +RF H+ ++AWN Sbjct: 171 PIDNGEGNGGDRFGHLVDIYAWN 193 >At5g65170.1 68418.m08197 VQ motif-containing protein contains PF05678: VQ motif Length = 362 Score = 26.2 bits (55), Expect = 9.6 Identities = 17/65 (26%), Positives = 29/65 (44%) Frame = -3 Query: 289 VPPQSNSPPGSVSNRITREF*TATSVSATSPLCTLGTKHRAPADIIDRAPLPPNRVSNET 110 VPP +S +N + + T + + TSP+C++ T + R P +RVS Sbjct: 91 VPPPISSEQVFFTNPLQQNLRTVPNTNTTSPICSVPTDKKNGL-ATTRNPKKRSRVSRRA 149 Query: 109 MKVVV 95 V+ Sbjct: 150 PTTVL 154 >At5g03450.1 68418.m00300 zinc finger (C3HC4-type RING finger) family protein Length = 630 Score = 26.2 bits (55), Expect = 9.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 349 VEQKGKSWLDPDVQVRIGTAKARLSI 426 +EQK SW + +VQ +I A+ RL + Sbjct: 203 IEQKTASWSNKEVQWKITEAELRLEV 228 >At3g48000.1 68416.m05233 aldehyde dehydrogenase (ALDH2) identical to aldehyde dehydrogenase [Arabidopsis thaliana] GI:8574427; similar to mitochondrial aldehyde dehydrogenase [Arabidopsis thaliana] gi|19850249|gb|AAL99612; identical to cDNA aldehyde dehydrogenase AtALDH2a GI:20530140 Length = 538 Score = 26.2 bits (55), Expect = 9.6 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +1 Query: 76 RAIVAEKPLLS-LFHYLLGWAEAVRG 150 +++ AE P+ + LF Y GWA+ + G Sbjct: 153 QSLTAEIPMFARLFRYYAGWADKIHG 178 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,898,109 Number of Sequences: 28952 Number of extensions: 204446 Number of successful extensions: 553 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 553 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 685039728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -