BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0772.Seq (399 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 4e-14 SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.016 SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) 31 0.46 SB_40420| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_36343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.4 SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_53612| Best HMM Match : SRCR (HMM E-Value=0) 27 4.3 SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) 27 4.3 SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_48941| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_17342| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_16538| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_14423| Best HMM Match : Attractin (HMM E-Value=7) 27 4.3 SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.3 SB_40461| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 SB_37277| Best HMM Match : Oxysterol_BP (HMM E-Value=0) 27 7.4 SB_57470| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.8 >SB_30799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 74.1 bits (174), Expect = 4e-14 Identities = 36/47 (76%), Positives = 39/47 (82%) Frame = -2 Query: 179 RAXRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR 39 R +PTY+TPLMS + RLESSSTGSSFPAD KPVPLAVVSLDSR Sbjct: 84 RRIATPTYSTPLMSFHRVRLESSSTGSSFPADCAKPVPLAVVSLDSR 130 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = -1 Query: 237 LPPNRVSNETMKVVVFQRR 181 LP +R+S +T++VVVF RR Sbjct: 67 LPLHRISKKTIRVVVFHRR 85 >SB_53001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.5 bits (78), Expect = 0.016 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = +2 Query: 2 AHEWINEIPTVPIYYLAKP 58 AHEWINEIPTVPI +P Sbjct: 9 AHEWINEIPTVPIIEFLQP 27 >SB_11380| Best HMM Match : Cathelicidins (HMM E-Value=9.6) Length = 149 Score = 30.7 bits (66), Expect = 0.46 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NSPPGSV Sbjct: 86 LTDVPPQPNSPPGSV 100 >SB_40420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 39 Score = 28.7 bits (61), Expect = 1.8 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 388 CAAPVKLAAWQCPPXGS 338 CAAP KL WQC GS Sbjct: 2 CAAPAKLPTWQCLRHGS 18 >SB_36343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.7 bits (61), Expect = 1.8 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -2 Query: 170 RSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVS 51 R PT P + Y +S TG +F AD P+ VP+ VS Sbjct: 117 RRPTDDPPPLPDYVMVRFTSYTGPAFIADDPQVVPIVPVS 156 >SB_35492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 2.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 396 LADAPPQSNSPPGSVLQXXPAEV 328 L D PPQ NS PGSV + V Sbjct: 99 LTDVPPQPNSQPGSVFDRGSSRV 121 >SB_22466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.9 bits (59), Expect = 3.2 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NSPP SV Sbjct: 99 LTDVPPQPNSPPDSV 113 >SB_54828| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_53018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_49027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_43801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_36335| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_34446| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_30555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 86 LTDVPPQPNSQPGSV 100 >SB_30421| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_29961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_27334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_26172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 86 LTDVPPQPNSQPGSV 100 >SB_10125| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_8324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_6437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 86 LTDVPPQPNSQPGSV 100 >SB_6297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_4512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_1263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_59770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_59175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_53612| Best HMM Match : SRCR (HMM E-Value=0) Length = 409 Score = 27.5 bits (58), Expect = 4.3 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 176 AXRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVP 66 A + T ATP SP R +++ SS SP P P Sbjct: 366 ASSASTPATPDSSPKRKRTRQANSASSSQPSSPHPAP 402 >SB_51965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_49932| Best HMM Match : DUF1518 (HMM E-Value=4.9) Length = 276 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 86 LTDVPPQPNSQPGSV 100 >SB_48984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_48941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 86 LTDVPPQPNSQPGSV 100 >SB_47625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_43908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_38656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_38497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_38371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 138 LTDVPPQPNSQPGSV 152 >SB_38049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 86 LTDVPPQPNSQPGSV 100 >SB_34847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 86 LTDVPPQPNSQPGSV 100 >SB_27307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 138 LTDVPPQPNSQPGSV 152 >SB_26275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_25093| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_23631| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_19329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 86 LTDVPPQPNSQPGSV 100 >SB_18891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_17342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 86 LTDVPPQPNSQPGSV 100 >SB_16538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 86 LTDVPPQPNSQPGSV 100 >SB_14423| Best HMM Match : Attractin (HMM E-Value=7) Length = 162 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 137 LTDVPPQPNSQPGSV 151 >SB_11715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_9762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_9131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_7799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_3610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_2425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 4.3 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 396 LADAPPQSNSPPGSV 352 L D PPQ NS PGSV Sbjct: 99 LTDVPPQPNSQPGSV 113 >SB_40461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 611 Score = 26.6 bits (56), Expect = 7.4 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 119 ESSSTGSSFPADSPKPVPLAVVSLDS 42 +S GSS AD P+P L V+LD+ Sbjct: 279 DSCRGGSSASADEPEPAGLVAVTLDA 304 >SB_37277| Best HMM Match : Oxysterol_BP (HMM E-Value=0) Length = 926 Score = 26.6 bits (56), Expect = 7.4 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +2 Query: 11 WINEIPTVPIYYLAKPQPRERAWENQRGKKTLLSLTLVW 127 W N+I + YL P + + +Q+G+ L ++W Sbjct: 762 WDNKIEAAKVVYLKSPGVKAQGSSSQKGQPQTLPPVVLW 800 >SB_57470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 41 Score = 26.2 bits (55), Expect = 9.8 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -2 Query: 182 DRAXRSPTYATPLMSPYNARLESSSTGSSFPADSP 78 D SPT TP P + ++S +GSS +P Sbjct: 3 DSGAHSPTCQTPSTPPRSLEIDSDMSGSSMGERTP 37 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,386,339 Number of Sequences: 59808 Number of extensions: 225844 Number of successful extensions: 602 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 562 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 602 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 703143849 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -