BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0771.Seq (399 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC064690-1|AAH64690.1| 530|Homo sapiens ZNF529 protein protein. 29 4.3 AK025110-1|BAB15068.1| 458|Homo sapiens protein ( Homo sapiens ... 29 4.3 AB046835-1|BAB13441.1| 484|Homo sapiens KIAA1615 protein protein. 29 4.3 >BC064690-1|AAH64690.1| 530|Homo sapiens ZNF529 protein protein. Length = 530 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 106 SQLM*LIYHPQVEVYQYTTYDNTSDFYKNXYYLPYQKV*NAIIHLC 243 S ++ L H V+ +Y Y NT FYK+ + YQK+ N + C Sbjct: 180 SSMLQLNIHTGVKPCKYMEYGNTCSFYKD--FNVYQKIHNEKFYKC 223 >AK025110-1|BAB15068.1| 458|Homo sapiens protein ( Homo sapiens cDNA: FLJ21457 fis, clone COL04705. ). Length = 458 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 106 SQLM*LIYHPQVEVYQYTTYDNTSDFYKNXYYLPYQKV*NAIIHLC 243 S ++ L H V+ +Y Y NT FYK+ + YQK+ N + C Sbjct: 108 SSMLQLNIHTGVKPCKYMEYGNTCSFYKD--FNVYQKIHNEKFYKC 151 >AB046835-1|BAB13441.1| 484|Homo sapiens KIAA1615 protein protein. Length = 484 Score = 29.5 bits (63), Expect = 4.3 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +1 Query: 106 SQLM*LIYHPQVEVYQYTTYDNTSDFYKNXYYLPYQKV*NAIIHLC 243 S ++ L H V+ +Y Y NT FYK+ + YQK+ N + C Sbjct: 134 SSMLQLNIHTGVKPCKYMEYGNTCSFYKD--FNVYQKIHNEKFYKC 177 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 43,510,690 Number of Sequences: 237096 Number of extensions: 653246 Number of successful extensions: 824 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 824 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2870859500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -