Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0771.Seq
         (399 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g42470.1 68414.m04897 patched family protein similar to SP|O1...    27   3.5  

>At1g42470.1 68414.m04897 patched family protein similar to SP|O15118
            Niemann-Pick C1 protein precursor from Homo sapiens
            (GB:AAB63982) (GI:2276463); contains Pfam profile PF02460
            Patched family
          Length = 1272

 Score = 27.5 bits (58), Expect = 3.5
 Identities = 10/34 (29%), Positives = 19/34 (55%)
 Frame = -1

Query: 234  YDSILDLLVRKIIXIFIKIASVVICCVLINLDLW 133
            ++  LD+    +I + I IA+V + C++I    W
Sbjct: 1078 FEQYLDIWKTALINLSIAIAAVFVVCLIITCSFW 1111


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,435,448
Number of Sequences: 28952
Number of extensions: 99547
Number of successful extensions: 196
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 193
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 196
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 575830496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)