BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0764.Seq (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1543 - 38138253-38138855,38139000-38139239 34 0.11 02_05_1277 - 35408097-35409080 29 4.2 05_05_0392 + 24629528-24630442 28 7.4 >01_06_1543 - 38138253-38138855,38139000-38139239 Length = 280 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 366 NTTDLYFDYYXFPPESYXYRYDAPGNPELANRIHEKLKNSG 488 N T F+ Y FP + Y APG P++A + E L+ +G Sbjct: 63 NDTIHDFEGYGFPKSMFQLEYPAPGAPDVAKKAKELLEQAG 103 >02_05_1277 - 35408097-35409080 Length = 327 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = +1 Query: 328 ALGGRRRYHFIR*TPPIYTLTTTA-SPLNHTXTDTTRQGILNWPIEYTKNLKTP 486 ALGG R H PP TT A + T DT ++G + +E NL P Sbjct: 229 ALGGHMRRHRPLHAPPERAATTAATTAATATAPDTKKEGSTSINLELDLNLPAP 282 >05_05_0392 + 24629528-24630442 Length = 304 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 268 SQEYSSPACSLSPNSGRGPPP 206 +QE +SPA S + RGPPP Sbjct: 238 AQETNSPASSTTTTQSRGPPP 258 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,874,568 Number of Sequences: 37544 Number of extensions: 290612 Number of successful extensions: 879 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 865 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -