BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0764.Seq (648 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59380| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_35265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 >SB_59380| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1226 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = -3 Query: 589 IFVLWXMSCRGINQKHRNENSVVXTSFGSNLESIPEFLSFSCILLANSGFPGASY 425 +F++W CR QK RN+ S+V T + P S + ++G G++Y Sbjct: 1121 LFIIWRCPCRLKGQKKRNQMSLVNTKAANGYTVPPRNSSHQTMSTNSTGQSGSTY 1175 >SB_35265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/31 (32%), Positives = 21/31 (67%) Frame = +3 Query: 57 VFMLILNTLTILIQVVFIXFMSILSMNILKY 149 +F +I+N I++ V+FI +SI++ I+ + Sbjct: 299 IFTIIINVTIIIVVVIFINVISIITTTIVNF 329 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,809,311 Number of Sequences: 59808 Number of extensions: 324785 Number of successful extensions: 775 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 775 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -