BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0764.Seq (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 4.8 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 23 8.3 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 8.3 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 23 8.3 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 23 8.3 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.8 bits (49), Expect = 4.8 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +2 Query: 179 GCSCSIRQPWRWTSAAVGGQGTRWTTVFLRDEVKKHVN 292 GC I P AA+ G G+R TTV R +N Sbjct: 873 GCGSGIASP----PAAIHGGGSRTTTVLKRTYSNSSIN 906 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 360 PVNTTDLYFDYYXF 401 P+ +TD YFDY F Sbjct: 476 PMQSTDKYFDYAVF 489 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 8.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +1 Query: 349 YHFIR*TPPIYTLTTTASP 405 Y R T P T TTTASP Sbjct: 663 YPIYRRTTPTTTTTTTASP 681 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 360 PVNTTDLYFDYYXF 401 P+ +TD YFDY F Sbjct: 476 PMQSTDKYFDYAVF 489 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 23.0 bits (47), Expect = 8.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +3 Query: 360 PVNTTDLYFDYYXF 401 P+ +TD YFDY F Sbjct: 476 PMQSTDKYFDYAVF 489 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 578,269 Number of Sequences: 2352 Number of extensions: 11679 Number of successful extensions: 66 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -