BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0763.Seq (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 31 0.007 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 1.5 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 23 2.0 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 4.5 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 4.5 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 4.5 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 22 4.5 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 22 4.5 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 4.5 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 4.5 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 4.5 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 4.5 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 4.5 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 6.0 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 7.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 31.1 bits (67), Expect = 0.007 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 3/42 (7%) Frame = -3 Query: 269 WNPSSWHPPGCPAQTP*GPTSQPLKPQ---YRLYLHHTQYSY 153 W P+ WHPP P + P + LKPQ +++ + T +++ Sbjct: 1369 WQPTEWHPP-IPPTSEKPPLPEELKPQSGYFKIVCYFTNWAW 1409 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.4 bits (48), Expect = 1.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 293 DNSSIPTSGSVFDCLVASSTSLRTL 367 DN P G++F L++ T LRTL Sbjct: 493 DNRRKPKPGTIFAKLLSVLTELRTL 517 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = -2 Query: 129 FVIFFNCGIYMAIPLVEIIYFCNGNTICYLR 37 F++FF G+ I + +Y C+ N +LR Sbjct: 142 FILFFAQGLTSPIFNLVYVYCCDNNFNVFLR 172 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 4.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 318 PEVGIEELSADIYYKNLEPFVLASTRLPRSNT 223 P G++ D Y L+P LAST L NT Sbjct: 62 PGHGLQPTMGD--YTQLQPQRLASTHLQSPNT 91 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 4.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 318 PEVGIEELSADIYYKNLEPFVLASTRLPRSNT 223 P G++ D Y L+P LAST L NT Sbjct: 62 PGHGLQPTMGD--YTQLQPQRLASTHLQSPNT 91 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.8 bits (44), Expect = 4.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 318 PEVGIEELSADIYYKNLEPFVLASTRLPRSNT 223 P G++ D Y L+P LAST L NT Sbjct: 62 PGHGLQPTMGD--YTQLQPQRLASTHLQSPNT 91 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = -2 Query: 324 TEPEVGIEELSADIYYKNLEPFV 256 T+P + + +SAD+Y ++ F+ Sbjct: 348 TQPMLVLNSVSADVYNLEIQRFI 370 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 21.8 bits (44), Expect = 4.5 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = -2 Query: 324 TEPEVGIEELSADIYYKNLEPFV 256 T+P + + +SAD+Y ++ F+ Sbjct: 348 TQPMLVLNSVSADVYNLEIQRFI 370 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 4.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 318 PEVGIEELSADIYYKNLEPFVLASTRLPRSNT 223 P G++ D Y L+P LAST L NT Sbjct: 62 PGHGLQPTMGD--YTQLQPQRLASTHLQSPNT 91 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 4.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 318 PEVGIEELSADIYYKNLEPFVLASTRLPRSNT 223 P G++ D Y L+P LAST L NT Sbjct: 62 PGHGLQPTMGD--YTQLQPQRLASTHLQSPNT 91 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 4.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 318 PEVGIEELSADIYYKNLEPFVLASTRLPRSNT 223 P G++ D Y L+P LAST L NT Sbjct: 18 PGHGLQPTMGD--YTQLQPQRLASTHLQSPNT 47 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.8 bits (44), Expect = 4.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 318 PEVGIEELSADIYYKNLEPFVLASTRLPRSNT 223 P G++ D Y L+P LAST L NT Sbjct: 62 PGHGLQPTMGD--YTQLQPQRLASTHLQSPNT 91 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 4.5 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 318 PEVGIEELSADIYYKNLEPFVLASTRLPRSNT 223 P G++ D Y L+P LAST L NT Sbjct: 62 PGHGLQPTMGD--YTQLQPQRLASTHLQSPNT 91 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 21.4 bits (43), Expect = 6.0 Identities = 11/39 (28%), Positives = 13/39 (33%) Frame = -1 Query: 511 HRCRTLVCRSDEGRGTGGEADQGPHHFVQGEDLESRARH 395 H CR S G E Q PH + S+ H Sbjct: 75 HHCRFKFSSSVGWSPAGHEEAQSPHRIYMHPESPSKGSH 113 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 7.9 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -3 Query: 260 SSWHPPGCPAQTP*GPTSQPLKPQYRL 180 S+W+P C T PL PQ+ L Sbjct: 487 SAWNPKDCDPLITLIETWMPLLPQWIL 513 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,517 Number of Sequences: 336 Number of extensions: 3041 Number of successful extensions: 24 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -