BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0760.Seq (597 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 31 0.009 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 31.1 bits (67), Expect = 0.009 Identities = 17/43 (39%), Positives = 22/43 (51%) Frame = +1 Query: 271 DNKPXVIVAVRGSYSXXNTDGKPETITYFVDXTGXHAQGESIP 399 DN+ V+ +GS S DG+ +ITY D G QG IP Sbjct: 64 DNETPVVS--QGSDSYTAPDGQQVSITYVADENGFQVQGSHIP 104 Score = 23.8 bits (49), Expect = 1.3 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 158 IVRSEFDASPDGAYNXNFETSN 223 I + + + DG Y NFETSN Sbjct: 29 ITSQQLEVNFDGNYINNFETSN 50 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,649 Number of Sequences: 438 Number of extensions: 1477 Number of successful extensions: 2 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -