BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0760.Seq (597 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62770.1 68414.m07085 invertase/pectin methylesterase inhibit... 28 5.4 >At1g62770.1 68414.m07085 invertase/pectin methylesterase inhibitor family protein similar to pectinesterase from Arabidopsis thaliana SP|Q42534, Lycopersicon esculentum SP|Q43143, Phaseolus vulgaris SP|Q43111; contains Pfam profile PF04043: Plant invertase/pectin methylesterase inhibitor Length = 204 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 59 NXPKLLKMKLIIVXAXALGATVIXAPXTEDYPKIVRSEFDASPD 190 N L + LII A A T+ A T++ PK R E+ A D Sbjct: 62 NDQDLAQTALIISLARAKSVTIFVAKLTKETPKFKRREYLAIKD 105 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,785,133 Number of Sequences: 28952 Number of extensions: 102437 Number of successful extensions: 220 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 217 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 220 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -