Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0758.Seq
         (499 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

01_04_0046 - 15400890-15403097                                         27   8.4  

>01_04_0046 - 15400890-15403097
          Length = 735

 Score = 27.1 bits (57), Expect = 8.4
 Identities = 17/61 (27%), Positives = 26/61 (42%)
 Frame = +2

Query: 110 SLGNSLPSEQAYLVFINQNLNTHCSLTLTLHNNH*FD*FFQKLGFCWSLSQSSGTMCEGC 289
           +L   +PS  + +      LN +C L +       FD   Q+  F WS +  +G   E C
Sbjct: 141 ALACKIPSAVSNVYVCTSLLNMYCKLGIVSDARRVFDGMPQRNSFSWS-TMVAGYAAEKC 199

Query: 290 S 292
           S
Sbjct: 200 S 200


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,136,895
Number of Sequences: 37544
Number of extensions: 159645
Number of successful extensions: 304
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 299
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 304
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1047416480
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)