BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0756.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08) 29 2.9 SB_15409| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 >SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08) Length = 338 Score = 29.1 bits (62), Expect = 2.9 Identities = 24/84 (28%), Positives = 40/84 (47%), Gaps = 9/84 (10%) Frame = -3 Query: 233 AYFIKLYTSMLHEQI*FKFSTMSFNFSLCFYI*LNKAI*TVYTCNVNYP---C----FYF 75 A+ +L ++ LHE++ +K +S L FY+ + V C +N P C F F Sbjct: 244 AWMRRLTSNSLHERVNYKVFKISLAIVLAFYLCYSCYWLQVTLCTLNEPPRLCANQTFRF 303 Query: 74 NSVFYFPIKKCVA--VICGSFNKR 9 +V Y I C ++C +F+ R Sbjct: 304 MNV-YLAIANCAVNPIVCLAFSSR 326 >SB_15409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 419 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 305 CRRGCRTTAGSCCGRTAASCRCCG 376 C +GCRT+ G CG C CG Sbjct: 257 CGKGCRTS-GKGCGTCGKGCGTCG 279 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,689,913 Number of Sequences: 59808 Number of extensions: 177824 Number of successful extensions: 588 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -