BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0747.Seq (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g17120.1 68417.m02578 expressed protein 32 0.29 At5g56860.1 68418.m07095 zinc finger (GATA type) family protein ... 28 4.7 At2g21810.1 68415.m02592 CHP-rich zinc finger protein, putative 28 4.7 At2g47800.1 68415.m05966 glutathione-conjugate transporter (MRP4... 27 8.1 At2g37800.1 68415.m04641 DC1 domain-containing protein contains ... 27 8.1 >At4g17120.1 68417.m02578 expressed protein Length = 1661 Score = 32.3 bits (70), Expect = 0.29 Identities = 11/24 (45%), Positives = 19/24 (79%) Frame = +2 Query: 32 LPRKAKILSKIYYTCFYISGALPI 103 L +K++ LS + YTC+++ GALP+ Sbjct: 450 LLKKSRFLSLLIYTCYFLQGALPL 473 >At5g56860.1 68418.m07095 zinc finger (GATA type) family protein similar to unknown protein (pir |T04270) Length = 398 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 94 PTNYSSLGNSLPSEQAYLVF-INQNLNTHCSLTLTLHNNH 210 P+N SS +S+ S +YL F IN + H + T H +H Sbjct: 44 PSNSSSSSSSISSLSSYLPFLINSQEDQHVAYNNTYHADH 83 >At2g21810.1 68415.m02592 CHP-rich zinc finger protein, putative Length = 128 Score = 28.3 bits (60), Expect = 4.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 415 SRNKQLCDICSENVRKLSQFC 353 S+ K CDIC EN+ + FC Sbjct: 68 SQEKMKCDICRENIYDFNLFC 88 >At2g47800.1 68415.m05966 glutathione-conjugate transporter (MRP4) identical to AtMRP4 GI:2959767 from [Arabidopsis thaliana] Length = 1516 Score = 27.5 bits (58), Expect = 8.1 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -3 Query: 346 FSVTQDQMTPTPGVSYIPLNTLHTWYQNFERGSSRIL 236 F VT PT IPL L+ WY+N+ SSR L Sbjct: 1085 FIVTCQYAWPT-AFFVIPLGWLNIWYRNYYLASSREL 1120 >At2g37800.1 68415.m04641 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 396 Score = 27.5 bits (58), Expect = 8.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 418 TSRNKQLCDICSENVRKLSQFC 353 T +NK++CDIC E+ L C Sbjct: 217 THQNKRMCDICDESAEGLYYQC 238 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,893,409 Number of Sequences: 28952 Number of extensions: 247519 Number of successful extensions: 573 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -