BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0746.Seq (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identica... 120 8e-28 >At2g07687.1 68415.m00937 cytochrome c oxidase subunit 3 identical to cytochrome c oxidase subunit 3 (GI:15215914) [Arabidopsis thaliana]; similar to Cytochrome c oxidase polypeptide III (EC 1.9.3.1) (Swiss-Prot:P92514) [Arabidopsis thaliana] Length = 265 Score = 120 bits (290), Expect = 8e-28 Identities = 56/95 (58%), Positives = 69/95 (72%) Frame = -3 Query: 311 IIFNYFIRILFYYFTSI*IIEASFTIADRIYGSTFFIATGFHGIHVIIGTLFLLICYIRH 132 ++ + ++F F + +A FTI+D IYGSTFF+ATGFHG HVIIGTLFL+IC IR Sbjct: 166 LVATVLLALVFTGFQGMEYYQAPFTISDSIYGSTFFLATGFHGFHVIIGTLFLIICGIRQ 225 Query: 131 LNNHFSKNHHFGFEAAA*Y*HFVDVV*LFLYISIY 27 H +K HH GFEAAA Y HFVDVV LFL++SIY Sbjct: 226 YLGHLTKEHHVGFEAAAWYWHFVDVVWLFLFVSIY 260 Score = 61.7 bits (143), Expect = 5e-10 Identities = 32/75 (42%), Positives = 42/75 (56%) Frame = -1 Query: 481 LSPNIEIGRI*PPSRITPFNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQRLFL 302 L+P +EIG I PP I +P++IP LNT IL SG VT AHH+++ + L Sbjct: 109 LAPAVEIGGIWPPKGIEVLDPWEIPFLNTPILPSSGAAVTWAHHAILAGKEKRAVYALVA 168 Query: 301 TILLGFYFTILQAYE 257 T+LL FT Q E Sbjct: 169 TVLLALVFTGFQGME 183 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,171,272 Number of Sequences: 28952 Number of extensions: 169893 Number of successful extensions: 247 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 247 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -