SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0744.Seq
         (748 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_05_0093 + 25753021-25753061,25753159-25753402,25753843-257539...    29   5.2  

>02_05_0093 +
           25753021-25753061,25753159-25753402,25753843-25753905,
           25753985-25754179,25754489-25754893
          Length = 315

 Score = 28.7 bits (61), Expect = 5.2
 Identities = 19/72 (26%), Positives = 38/72 (52%), Gaps = 11/72 (15%)
 Frame = +2

Query: 47  IWSVDFSLNNIDIWKG----GFSM*MQYLAEHTHKNSQSS-------FNGNKKCVNIVIT 193
           I  V F   N+D+ K       +  +++L +HT + ++++       ++GNKK +  ++ 
Sbjct: 101 ILGVTFDFGNLDLNKAIEGKSANETLEWLMQHTVETAENAEECLKINYHGNKKTIQALLP 160

Query: 194 SIQSSMSPRILT 229
            +QSS   RI+T
Sbjct: 161 LLQSSPDGRIVT 172


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,231,916
Number of Sequences: 37544
Number of extensions: 274543
Number of successful extensions: 445
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 438
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 445
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1980691104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -