BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0742.Seq (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF047659-11|AAC04428.1| 182|Caenorhabditis elegans Hypothetical... 27 9.8 AF043699-3|AAB97566.1| 1220|Caenorhabditis elegans Temporarily a... 27 9.8 >AF047659-11|AAC04428.1| 182|Caenorhabditis elegans Hypothetical protein K07H8.3 protein. Length = 182 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +1 Query: 391 NIHCRHLS*IESRTNSN--DIPENYIMSFIFY 480 NI C + + S N+N +PENY M + FY Sbjct: 2 NIRCARVDDLMSMQNANLMCLPENYQMKYYFY 33 >AF043699-3|AAB97566.1| 1220|Caenorhabditis elegans Temporarily assigned gene nameprotein 203 protein. Length = 1220 Score = 27.5 bits (58), Expect = 9.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +2 Query: 422 NQGLIQTTYQRIILCLLFFMSSEEVLNYNN 511 N+ L+ TT I CL+ FMS +EV + N Sbjct: 1117 NEALVYTTIGGAIGCLVSFMSKDEVDFFTN 1146 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,843,838 Number of Sequences: 27780 Number of extensions: 201678 Number of successful extensions: 367 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 367 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -