BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0741.Seq (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC685.03 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 29 0.48 SPBC776.08c |||Nrap|Schizosaccharomyces pombe|chr 2|||Manual 25 7.9 >SPBC685.03 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 452 Score = 29.5 bits (63), Expect = 0.48 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = -1 Query: 305 AAAYYKSESVVTVTL-LVGHSSTGTHFPDLSNRKPSSQWHVGSNAATQLVCVRSGSSQ 135 A+ Y +S S T T+ G S G+ +P S S W+ ++AAT S SSQ Sbjct: 126 ASNYTQSSSNSTSTMNSTGSVSGGSVYPTNSTTNSSISWNSSTSAATNTSSSSSSSSQ 183 >SPBC776.08c |||Nrap|Schizosaccharomyces pombe|chr 2|||Manual Length = 1097 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 484 HGLRFLSEVFSNGNSFGEGTANERTV*FW 570 H FL +FSN +F N+R + FW Sbjct: 746 HNCCFLQVLFSNNFTFRYRLRNDREIFFW 774 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,180,881 Number of Sequences: 5004 Number of extensions: 70587 Number of successful extensions: 174 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 174 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -