BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0740.Seq (527 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 26 0.90 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 8.4 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 25.8 bits (54), Expect = 0.90 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 257 LPSAFGFLFRYNVLFINFSFYRLRFRIFNYFCFASS 150 L AFG +F +N + + RLR+ F CF + Sbjct: 359 LSCAFGAVFIFNYIPLQEGTTRLRYTFFYAVCFVET 394 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 22.6 bits (46), Expect = 8.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 129 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKT 242 D+++ ++ G K+ ++P TESVE E E KT Sbjct: 565 DDESKEQTYGDPKIEDNP-TESVEIEWSLDETKREAKT 601 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 402,843 Number of Sequences: 2352 Number of extensions: 6197 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 48628785 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -