BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0739.Seq (518 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 23 6.2 AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 23 8.1 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 23.0 bits (47), Expect = 6.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -1 Query: 116 SWIVARRTSAKAFAKGVFINQERKLEVRR 30 +W++ RT KG Q +KLE R+ Sbjct: 23 TWVMVYRTEKYQKLKGEVEKQSKKLEKRK 51 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 22.6 bits (46), Expect = 8.1 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +3 Query: 336 LILNRRFLE--RRLTDDMLRKRVSITADAVHRQRGXQM 443 L LN+ + R+ D++++ SIT +AVH + +M Sbjct: 322 LALNQELQDKARQNITDVMKQHSSITYEAVHEMKYIEM 359 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 484,608 Number of Sequences: 2352 Number of extensions: 9082 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47360208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -