BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0738.Seq (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 5.5 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 21 7.3 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.8 bits (44), Expect = 5.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -2 Query: 457 SASWQELASLITRLNNFVFKKI 392 S ++EL S + R+N FV+ I Sbjct: 603 STPFKELTSNVFRMNQFVYDAI 624 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 21.4 bits (43), Expect = 7.3 Identities = 10/42 (23%), Positives = 23/42 (54%) Frame = +3 Query: 387 QYIFLNTKLFSLVMREASSCQDADMIDK*IKKQKYQGASXDY 512 +++ +N ++ +++ S +A +D K + QGA+ DY Sbjct: 303 KWLLVNFDCSTMWLKDPSWLVNAFNVDPLYLKHEQQGAAPDY 344 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,897 Number of Sequences: 336 Number of extensions: 3383 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -