BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0737.Seq (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2E12.03c |||G-protein coupled receptor |Schizosaccharomyces ... 26 6.0 SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr... 25 7.9 SPBC17G9.04c |nup85||nucleoporin Nup85|Schizosaccharomyces pombe... 25 7.9 SPBC530.11c |||transcription factor |Schizosaccharomyces pombe|c... 25 7.9 >SPAC2E12.03c |||G-protein coupled receptor |Schizosaccharomyces pombe|chr 1|||Manual Length = 283 Score = 25.8 bits (54), Expect = 6.0 Identities = 15/46 (32%), Positives = 25/46 (54%), Gaps = 3/46 (6%) Frame = +2 Query: 254 TLYYYYWKLRGFCLSTIN-IQQA--ALVLVNFVFEAIVYLSLFQCL 382 TL+ W + LS N +Q+ AL + +F+A+ + + FQCL Sbjct: 52 TLFILSWVVASIPLSVYNQVQELNIALKVQPELFQALAFTTFFQCL 97 >SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr 2|||Manual Length = 1471 Score = 25.4 bits (53), Expect = 7.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 192 DTNACVSL*SMESGILSDYVELCTIITGN*EVFV 293 D C+SL + GILS E C + +GN + F+ Sbjct: 493 DNQGCISLIEDKLGILSLLDEECRLPSGNHQSFL 526 >SPBC17G9.04c |nup85||nucleoporin Nup85|Schizosaccharomyces pombe|chr 2|||Manual Length = 675 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 222 MESGILSDYVELCTIITGN*EVFVL 296 ++S +L D+V L I+ GN EV +L Sbjct: 297 IDSEVLDDFVVLLDILNGNKEVIML 321 >SPBC530.11c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 819 Score = 25.4 bits (53), Expect = 7.9 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 602 VVLTEFVHYSYFCSRMSRYW 661 V + FV SY C+ S+YW Sbjct: 282 VYVASFVMLSYVCAATSKYW 301 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,707,454 Number of Sequences: 5004 Number of extensions: 52814 Number of successful extensions: 86 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 85 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -